Lus10024720 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G07830 194 / 7e-65 ribosomal protein L29 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032334 236 / 6e-81 AT1G07830 204 / 3e-68 ribosomal protein L29 family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G111100 213 / 2e-72 AT1G07830 216 / 2e-73 ribosomal protein L29 family protein (.1)
Potri.002G185800 194 / 6e-65 AT1G07830 203 / 3e-68 ribosomal protein L29 family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0346 Ribo_L29 PF06984 MRP-L47 Mitochondrial 39-S ribosomal protein L47 (MRP-L47)
Representative CDS sequence
>Lus10024720 pacid=23161522 polypeptide=Lus10024720 locus=Lus10024720.g ID=Lus10024720.BGIv1.0 annot-version=v1.0
ATGTTTATGATGAGATTTTTTGGGAGAAGCCTCCTTGCTTCTGCGAGATCTGAATCATCCACAGCAACAGCTGCTACATCAGCTAGTCTTGGACATAACC
CTCTTGAGCAGTTCTTTGAGATAGACAGGAGAGAAGATGATGAGAAGCCTGTAGTGTATGGTCGGAGCTGGAAAGCCTCTGAATTGCGGTTGAAATCTTG
GGATGATCTACAGAAGCTGTGGTACGTCCTTATGAAGGAGAAGAACATGCTTATGACTCAACGCCAGATGCTTCATTCCCAGAACCTGAGATTTCCAAAT
CCAGAGCGCATGCCGAAAGTTAGGAAGTCGATGTGCCGCATCAAGCAAGTGCTCACTGAGAGAGCAATCGAAGATCCGGATCCAAGGAGGTCTGCCGAGA
TGAAGAGGATGGTAAATGCATTGTAA
AA sequence
>Lus10024720 pacid=23161522 polypeptide=Lus10024720 locus=Lus10024720.g ID=Lus10024720.BGIv1.0 annot-version=v1.0
MFMMRFFGRSLLASARSESSTATAATSASLGHNPLEQFFEIDRREDDEKPVVYGRSWKASELRLKSWDDLQKLWYVLMKEKNMLMTQRQMLHSQNLRFPN
PERMPKVRKSMCRIKQVLTERAIEDPDPRRSAEMKRMVNAL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G07830 ribosomal protein L29 family p... Lus10024720 0 1
Lus10032698 4.9 0.8566
AT5G15220 Ribosomal protein L27 family p... Lus10007170 5.6 0.8808
AT2G44860 Ribosomal protein L24e family ... Lus10020552 7.1 0.8646
AT2G34050 unknown protein Lus10013954 9.2 0.8403
AT3G10530 Transducin/WD40 repeat-like su... Lus10035742 15.1 0.8543
AT5G44200 ATCBP20, CBP20 CAP-binding protein 20 (.1.2) Lus10017682 16.0 0.8593
AT5G64816 unknown protein Lus10025266 16.0 0.7881
AT5G18540 unknown protein Lus10002878 17.5 0.8475
AT2G45520 unknown protein Lus10015859 19.0 0.8529
AT4G17510 UCH3 ubiquitin C-terminal hydrolase... Lus10026940 20.6 0.8530

Lus10024720 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.