Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G11591 74 / 1e-19 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032336 [exp] 124 / 1e-39 AT3G11591 77 / 1e-20 unknown protein Lus10016986 [exp] 56 / 3e-12 AT3G11591 44 / 1e-07 unknown protein
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.006G207600 [exp] 83 / 2e-23 AT3G11591 89 / 1e-25 unknown protein Potri.008G011620 [exp] 59 / 2e-13 AT3G11591 44 / 6e-08 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024722 pacid=23161605 polypeptide=Lus10024722 locus=Lus10024722.g ID=Lus10024722.BGIv1.0 annot-version=v1.0 ATGGCGATCTGGACGTACCCGCCGACGAGGAAGCAAGCGGCGGCGATGATGGTTATGTTCACAGCCGGAGCTTCGCTGTTCAGCTACGGCGCCCACATGT CTCTGAAGAACGTGGAACCTCAGCAAGAGCGTACAAGAGCTCGGAATGAATTTGTGAAAGAGCGGATCCGGAAGTTGATCGGAGAAGACTAG
AA sequence Show only first row Show all	>Lus10024722 pacid=23161605 polypeptide=Lus10024722 locus=Lus10024722.g ID=Lus10024722.BGIv1.0 annot-version=v1.0 MAIWTYPPTRKQAAAMMVMFTAGASLFSYGAHMSLKNVEPQQERTRARNEFVKERIRKLIGED

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G11591			unknown protein		Lus10024722 [exp]	0	1
AT1G07170			PHF5-like protein (.1.2.3)		Lus10040654 [exp]	16.4	0.7395
AT4G26210			Mitochondrial ATP synthase sub...		Lus10040553 [exp]	30.7	0.6591
AT1G62810			Copper amine oxidase family pr...		Lus10032206 [exp]	45.5	0.6399
AT5G57860			Ubiquitin-like superfamily pro...		Lus10036598 [exp]	47.4	0.6854
AT2G36930	C2H2ZnF		zinc finger (C2H2 type) family...		Lus10014426 [exp]	52.0	0.6599
AT5G64350		FKP12, ATFKBP12...	ARABIDOPSIS THALIANA FK506-BIN...		Lus10003760 [exp]	52.2	0.6819
AT2G36130			Cyclophilin-like peptidyl-prol...		Lus10021335 [exp]	52.6	0.6746
AT3G54826			Zim17-type zinc finger protein...		Lus10037983 [exp]	54.9	0.6296
					Lus10035378 [exp]	71.8	0.6702
AT2G28430			unknown protein		Lus10022580 [exp]	90.3	0.6537

Compare expression of checked genes

Lus10024722 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.