Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G45680 163 / 2e-51 ATFKBP13 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) AT4G39710 102 / 3e-27 PnsL4, FKBP16-2 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) AT3G25220 76 / 7e-18 FKBP15-1 FK506-binding protein 15 kD-1 (.1) AT5G48580 75 / 2e-17 FKBP15-2 FK506- and rapamycin-binding protein 15 kD-2 (.1) AT2G43560 75 / 8e-17 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G25340 69 / 6e-14 ATFKBP53 FK506 BINDING PROTEIN 53 (.1.2) AT3G10060 67 / 6e-14 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G48570 67 / 3e-13 ROF2, ATFKBP65 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 62 / 9e-13 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G25230 59 / 2e-10 ROF1, ATFKBP62 FK506 BINDING PROTEIN 62, rotamase FKBP 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10006949 [exp] 230 / 1e-77 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10016811 [exp] 105 / 1e-28 AT4G39710 271 / 5e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10022507 [exp] 105 / 2e-28 AT4G39710 270 / 8e-93 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Lus10025889 [exp] 77 / 2e-18 AT5G48580 196 / 1e-65 FK506- and rapamycin-binding protein 15 kD-2 (.1) Lus10031121 [exp] 79 / 2e-17 AT4G25340 335 / 3e-110 FK506 BINDING PROTEIN 53 (.1.2) Lus10038215 [exp] 78 / 5e-17 AT3G25210 368 / 4e-125 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10031700 [exp] 77 / 5e-17 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10003170 [exp] 73 / 1e-16 AT3G25220 226 / 4e-77 FK506-binding protein 15 kD-1 (.1) Lus10002339 [exp] 73 / 1e-16 AT3G25220 227 / 1e-77 FK506-binding protein 15 kD-1 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.001G075500 [exp] 177 / 1e-56 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.005G079700 [exp] 108 / 8e-30 AT4G39710 243 / 1e-81 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.012G129200 [exp] 78 / 2e-17 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2) Potri.002G248200 [exp] 75 / 2e-17 AT5G48580 228 / 1e-77 FK506- and rapamycin-binding protein 15 kD-2 (.1) Potri.007G087401 [exp] 66 / 3e-14 AT4G39710 158 / 1e-49 Photosynthetic NDH subcomplex L 4, FK506-binding protein 16-2 (.1.2) Potri.015G130900 [exp] 69 / 6e-14 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.014G149400 [exp] 68 / 9e-14 AT5G48570 741 / 0.0 FKBP-type peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.007G134600 [exp] 67 / 9e-14 AT2G43560 286 / 2e-98 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.017G017500 [exp] 66 / 2e-13 AT2G43560 281 / 3e-96 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 65 / 4e-13 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [flax] [poplar] FKBP PF00254 [flax] [poplar] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Lus10024735 pacid=23159520 polypeptide=Lus10024735 locus=Lus10024735.g ID=Lus10024735.BGIv1.0 annot-version=v1.0 ATGAACTCGTTGGCATTTTCGGTTGGGCACTGCACACCCAGGAGGAAATTGAGCACAAAGGCAATGGTGAAGAAGGCTGAAACAACCGAATATTCTTCAT CAACTCAGAAGCAGCTGAAACTGTTCCATGTGAATTTGACTTCTACTCCTTCCGGCCTTTCCTTCTGTGACAAAGTTGTGGGAAGTGGCCTGGAGGCTGT GAAGGGACAACTGATTAAGGCGCATTACGTTGGGAAACTGGAAAATGGGCAGGTCTTTCATAGCAGCTACAATCGTGGGAAGCCTCTCACTTTTCAAGTA GGAGTCGGTGAGGTGATCCAAGGTTGGAACCGAGGAATCATTGGGGGTGATGCAATGCATGCTGGAGGAAAACGTGTATTGAAGATCCCACCAGAACTTG GATATGGTATTAGAGGGGCTGGCTGCAGAGGAGGTTCATGTATAATTCCTCCAAACTCGGTACTTGTGTTCGATGTGGAATTCATTGGCAAGGCATGA
AA sequence Show only first row Show all	>Lus10024735 pacid=23159520 polypeptide=Lus10024735 locus=Lus10024735.g ID=Lus10024735.BGIv1.0 annot-version=v1.0 MNSLAFSVGHCTPRRKLSTKAMVKKAETTEYSSSTQKQLKLFHVNLTSTPSGLSFCDKVVGSGLEAVKGQLIKAHYVGKLENGQVFHSSYNRGKPLTFQV GVGEVIQGWNRGIIGGDAMHAGGKRVLKIPPELGYGIRGAGCRGGSCIIPPNSVLVFDVEFIGKA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G45680		ATFKBP13	FK506 BINDING PROTEIN 13, FK50...		Lus10024735 [exp]	0	1
AT5G27560			Domain of unknown function (DU...		Lus10004486 [exp]	7.5	0.8819
AT5G44600			S-adenosyl-L-methionine-depend...		Lus10001217 [exp]	9.0	0.9027
AT5G40160		EMB139, EMB506	embryo defective 506, EMBRYO D...		Lus10032165 [exp]	10.0	0.8822
AT5G10620			methyltransferases (.1)		Lus10020175 [exp]	11.2	0.8770
AT2G31840		MRL7-L	Mesophyll-cell RNAi Library li...		Lus10020901 [exp]	16.2	0.8664
AT1G30520		AAE14	acyl-activating enzyme 14 (.1)		Lus10036027 [exp]	19.8	0.8805
AT5G26880		AGL26	AGAMOUS-like 26 (.1.2)		Lus10015701 [exp]	20.2	0.8622
AT3G57810			Cysteine proteinases superfami...		Lus10020438 [exp]	20.8	0.8711
AT2G25870			haloacid dehalogenase-like hyd...		Lus10005489 [exp]	23.6	0.8601
AT3G13180			NOL1/NOP2/sun family protein /...		Lus10022523 [exp]	23.9	0.8335

Compare expression of checked genes

Lus10024735 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.