Lus10024762 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010798 106 / 1e-27 AT5G27260 61 / 5e-10 unknown protein
Lus10032816 99 / 1e-26 AT2G24960 57 / 1e-09 unknown protein
Lus10006034 98 / 8e-26 AT5G27260 42 / 2e-04 unknown protein
Lus10028091 98 / 1e-25 ND /
Lus10004397 99 / 2e-25 AT5G27260 77 / 6e-16 unknown protein
Lus10022993 90 / 7e-23 ND /
Lus10026427 87 / 3e-22 ND /
Lus10022379 89 / 5e-22 AT5G27260 74 / 1e-14 unknown protein
Lus10001769 85 / 1e-21 ND /
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10024762 pacid=23159547 polypeptide=Lus10024762 locus=Lus10024762.g ID=Lus10024762.BGIv1.0 annot-version=v1.0
ATGAACAATAAGCCACTCGGTCTCTGGGATGATTTCTGCATCATATTTGGGTTAGACCAAGCACTTGGTGTAGATGCTGCCCAGCCCTCAGATGCAGCAA
GCAAAATGCTGTCAGGTGCAAGCGCCTCCGATTTCATGGAGGAACAAACCGATCCGACTGATTCCTGCACCATTCCACCTGACTCAGACCATGACGCAGT
GATAGAAGATATCCTCAATCAAGGCGATCTAGCAGTGAAACGTCAGTATTTGTATGATGAGCTTGCAAACTTCACCATGCTCATTGTCAGCCAAAGAACA
AGGGCAATGAGGCACCTCAATCGTGATGATGGTGATGTTGTTACCTTCTTTCAGTTACCAACTGAAGAGGAGAAGATGGAATTTATTTGGACGATTCTTG
AGTAA
AA sequence
>Lus10024762 pacid=23159547 polypeptide=Lus10024762 locus=Lus10024762.g ID=Lus10024762.BGIv1.0 annot-version=v1.0
MNNKPLGLWDDFCIIFGLDQALGVDAAQPSDAASKMLSGASASDFMEEQTDPTDSCTIPPDSDHDAVIEDILNQGDLAVKRQYLYDELANFTMLIVSQRT
RAMRHLNRDDGDVVTFFQLPTEEEKMEFIWTILE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024762 0 1
AT5G67360 ARA12 Subtilase family protein (.1) Lus10027891 3.5 1.0000
Lus10026042 4.5 1.0000
AT5G24070 Peroxidase superfamily protein... Lus10027049 5.7 1.0000
AT1G22400 ATUGT85A1, UGT8... ARABIDOPSIS THALIANA UDP-GLUCO... Lus10027513 6.0 1.0000
Lus10027530 6.3 1.0000
Lus10002313 6.5 1.0000
Lus10003831 7.5 1.0000
AT5G64790 O-Glycosyl hydrolases family 1... Lus10005788 8.0 1.0000
Lus10023520 8.4 1.0000
Lus10006010 8.5 1.0000

Lus10024762 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.