Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10025885 [exp] 69 / 1e-15 AT3G07360 499 / 2e-175 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3) Lus10038218 [exp] 64 / 7e-14 AT3G07360 489 / 2e-171 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3) Lus10020413 [exp] 51 / 3e-09 AT3G07360 478 / 8e-167 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3) Lus10009594 [exp] 49 / 1e-08 AT3G07360 482 / 2e-168 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G029500 [exp] 37 / 0.0002 AT3G07360 495 / 6e-174 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3) Potri.002G248600 [exp] 37 / 0.0003 AT3G07360 573 / 0.0 ARABIDOPSIS THALIANA PLANT U-BOX 9, plant U-box 9 (.1.2.3)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024776 pacid=23159525 polypeptide=Lus10024776 locus=Lus10024776.g ID=Lus10024776.BGIv1.0 annot-version=v1.0 ATGAACACCGATAAGTTCTACAACGAATGCATCTTCTACGAAAACAAGGCGAAAGCAGTGAAGGCAGGTGCTGTGAGTGTAGTTCTGGACAAGATAAAGA AAGGTGTATTGGTAAATGAGTTGTTGGCTATCATGGCAATGTTGTGTAGTTGCCAGAGGGCTCTCATCATGATAGGCGAAGAAGAGTGA
AA sequence Show only first row Show all	>Lus10024776 pacid=23159525 polypeptide=Lus10024776 locus=Lus10024776.g ID=Lus10024776.BGIv1.0 annot-version=v1.0 MNTDKFYNECIFYENKAKAVKAGAVSVVLDKIKKGVLVNELLAIMAMLCSCQRALIMIGEEE

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G07360		ATPUB9	ARABIDOPSIS THALIANA PLANT U-B...		Lus10024776 [exp]	0	1
AT5G24670		TAD3, EMB2820	tRNA adenosine deaminase 3, EM...		Lus10040753 [exp]	2.4	0.8929
AT2G38940		PHT1;4, ATPT2	ARABIDOPSIS THALIANA PHOSPHATE...		Lus10033866 [exp]	2.8	0.8915
AT4G18690			unknown protein		Lus10025399 [exp]	4.0	0.8441
AT5G01110			Tetratricopeptide repeat (TPR)...		Lus10028942 [exp]	5.5	0.8770
AT1G22540			Major facilitator superfamily ...		Lus10001287 [exp]	9.2	0.8571
					Lus10009699 [exp]	11.4	0.8890
AT1G60170		EMB1220	embryo defective 1220, pre-mRN...		Lus10002830 [exp]	13.6	0.7918
AT3G28540			P-loop containing nucleoside t...		Lus10007270 [exp]	15.5	0.8820
AT1G22620		ATSAC1	suppressor of actin 1, Phospho...		Lus10016941 [exp]	15.9	0.8616
AT1G68490			unknown protein		Lus10027557 [exp]	16.4	0.8431

Compare expression of checked genes

Lus10024776 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.