Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018705 [exp] 74 / 2e-17 AT4G24220 590 / 0.0 VEIN PATTERNING 1, Δ4,5-steroid-5[beta]-reductase, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Lus10032854 [exp] 53 / 8e-10 AT4G24220 577 / 0.0 VEIN PATTERNING 1, Δ4,5-steroid-5[beta]-reductase, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G120600 [exp] 46 / 3e-07 AT4G24220 577 / 0.0 VEIN PATTERNING 1, Δ4,5-steroid-5[beta]-reductase, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2) Potri.014G019600 [exp] 42 / 8e-06 AT4G24220 550 / 0.0 VEIN PATTERNING 1, Δ4,5-steroid-5[beta]-reductase, NAD(P)-binding Rossmann-fold superfamily protein (.1), NAD(P)-binding Rossmann-fold superfamily protein (.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024788 pacid=23178896 polypeptide=Lus10024788 locus=Lus10024788.g ID=Lus10024788.BGIv1.0 annot-version=v1.0 ATGAGCTGGTGGTGGGCTGGCGCCATTGGAGCTGCTAAGAAGAAGCTCGACGAAGACGAGGCTCCCCCCCCCCCCCGCTCCCCAAGGCGGCCAATGGAAG GTATACGGCGTCGCTCGTCGCCCCCGCCCCAATTGGAACGCCGATCATCCGATCGAGTACATCCAGTGCGACATCTCCGACCGAAACGACGCCGAATCAA AGCTCTCCCAGCTCACTGA
AA sequence Show only first row Show all	>Lus10024788 pacid=23178896 polypeptide=Lus10024788 locus=Lus10024788.g ID=Lus10024788.BGIv1.0 annot-version=v1.0 MSWWWAGAIGAAKKKLDEDEAPPPPRSPRRPMEGIRRRSSPPPQLERRSSDRVHPVRHLRPKRRRIKALPAH

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024788 [exp]	0	1
AT2G01818			PLATZ transcription factor fam...		Lus10028998 [exp]	3.5	0.8906
AT4G26140		BGAL12	beta-galactosidase 12 (.1.2)		Lus10040557 [exp]	4.7	0.9014
AT3G15358			unknown protein		Lus10011176 [exp]	4.9	0.8877
AT4G32190			Myosin heavy chain-related pro...		Lus10041037 [exp]	5.7	0.8944
AT2G35800		SAMTL	S-adenosyl methionine transpor...		Lus10023493 [exp]	9.0	0.8923
AT5G49650		XK2, XK-2	XYLULOSE KINASE 2, xylulose ki...		Lus10028235 [exp]	11.2	0.8785
AT3G10740		ATASD1, ARAF1, ...	ARABIDOPSIS THALIANA ALPHA-L-A...		Lus10038988 [exp]	12.2	0.8710
AT1G03090		MCCA	methylcrotonyl-CoA carboxylase...		Lus10042623 [exp]	13.4	0.8895
AT2G05160	C3HZnF		CCCH-type zinc fingerfamily pr...		Lus10012333 [exp]	13.7	0.8739
AT1G79750		ATNADP-ME4	Arabidopsis thaliana NADP-mali...		Lus10014149 [exp]	15.9	0.8670

Compare expression of checked genes

Lus10024788 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.