Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G59845 96 / 1e-27 Gibberellin-regulated family protein (.1) AT2G39540 94 / 8e-27 Gibberellin-regulated family protein (.1) AT2G14900 91 / 2e-25 Gibberellin-regulated family protein (.1) AT1G10588 84 / 6e-23 Gibberellin-regulated family protein (.1.2) AT1G74670 63 / 2e-14 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT5G15230 60 / 3e-13 GASA4 GAST1 protein homolog 4 (.1.2) AT2G18420 56 / 7e-12 Gibberellin-regulated family protein (.1) AT1G22690 56 / 1e-11 Gibberellin-regulated family protein (.1.2.3) AT4G09600 54 / 3e-11 GASA3 GAST1 protein homolog 3 (.1) AT1G75750 54 / 5e-11 GASA1 GAST1 protein homolog 1 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018708 [exp] 112 / 4e-34 AT5G59845 114 / 8e-35 Gibberellin-regulated family protein (.1) Lus10001407 [exp] 92 / 1e-25 AT5G59845 95 / 6e-27 Gibberellin-regulated family protein (.1) Lus10042012 [exp] 74 / 2e-18 AT1G74670 96 / 6e-27 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10018016 [exp] 72 / 2e-17 AT1G74670 110 / 2e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10029340 [exp] 68 / 1e-16 AT2G30810 108 / 3e-32 Gibberellin-regulated family protein (.1) Lus10005241 [exp] 65 / 3e-15 ND 96 / 4e-27 Lus10030680 [exp] 65 / 4e-15 AT5G15230 131 / 5e-41 GAST1 protein homolog 4 (.1.2) Lus10004048 [exp] 65 / 4e-15 AT1G74670 109 / 1e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Lus10002059 [exp] 64 / 6e-15 AT1G74670 132 / 1e-41 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G020100 [exp] 110 / 1e-33 AT5G59845 99 / 9e-29 Gibberellin-regulated family protein (.1) Potri.001G297700 [exp] 98 / 2e-28 AT2G14900 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.009G092600 [exp] 97 / 4e-28 AT2G14900 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G315500 [exp] 78 / 2e-20 AT2G30810 91 / 5e-25 Gibberellin-regulated family protein (.1) Potri.007G051300 [exp] 68 / 2e-16 AT2G14900 61 / 3e-13 Gibberellin-regulated family protein (.1) Potri.006G044400 [exp] 67 / 4e-16 AT1G74670 108 / 9e-32 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.001G254100 [exp] 67 / 5e-16 AT1G74670 111 / 4e-33 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) Potri.013G113400 [exp] 65 / 2e-15 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1) Potri.017G124200 [exp] 64 / 1e-14 AT3G02885 101 / 1e-29 GAST1 protein homolog 5 (.1) Potri.005G239000 [exp] 61 / 9e-14 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [flax] [poplar] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Lus10024791 pacid=23178871 polypeptide=Lus10024791 locus=Lus10024791.g ID=Lus10024791.BGIv1.0 annot-version=v1.0 ATGAAGGCAACACTTTTGATCATTTCCCTTCTTCTCATCACATCCTCTGTTACTTCTGCTGCTTCTGGTGAGTCATCGTGGTGTGATTCAAAGTGCGGAG TAAGGTGCTCTAAAGCAGGGTTGAAAGATAGATGCCTGAAGTACTGTGGGATATGCTGTGAAAAGTGCAGCTGCGTTCCTTCGGGGACTTACGGCAACAA GGATGAGTGTCCTTGCTACAGAGACTTGAAGAACTCCAAGGGCAACCCAAAGTGCCCTTAA
AA sequence Show only first row Show all	>Lus10024791 pacid=23178871 polypeptide=Lus10024791 locus=Lus10024791.g ID=Lus10024791.BGIv1.0 annot-version=v1.0 MKATLLIISLLLITSSVTSAASGESSWCDSKCGVRCSKAGLKDRCLKYCGICCEKCSCVPSGTYGNKDECPCYRDLKNSKGNPKCP

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G59845			Gibberellin-regulated family p...		Lus10024791 [exp]	0	1
AT5G54250		HLM1, DND2, ATC...	DEFENSE, NO DEATH 2, cyclic nu...		Lus10010061 [exp]	8.9	0.7269
AT5G18430			GDSL-like Lipase/Acylhydrolase...		Lus10004774 [exp]	12.0	0.7212
AT2G43820		SGT1, ATSAGT1, ...	UDP-glucose:salicylic acid glu...		Lus10024834 [exp]	13.7	0.7160
AT1G71680			Transmembrane amino acid trans...		Lus10008263 [exp]	21.5	0.6937
AT5G11420			Protein of unknown function, D...		Lus10013112 [exp]	26.3	0.6880
AT5G45960			GDSL-like Lipase/Acylhydrolase...		Lus10005280 [exp]	26.9	0.6501
AT5G19730			Pectin lyase-like superfamily ...		Lus10009997 [exp]	27.7	0.6707
AT4G24140		BDG3	alpha/beta-Hydrolases superfam...		Lus10033234 [exp]	28.1	0.6901
AT5G18050			SAUR-like auxin-responsive pro...		Lus10008994 [exp]	32.2	0.6929
AT5G44230			Pentatricopeptide repeat (PPR)...		Lus10025982 [exp]	33.2	0.6113

Compare expression of checked genes

Lus10024791 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.