Lus10024795 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G16150 503 / 0 ASPGB1 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
AT5G08100 329 / 1e-112 ASPGA1 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT4G00590 78 / 5e-16 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
AT5G61540 78 / 6e-16 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034655 313 / 7e-106 AT5G08100 507 / 0.0 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10034668 312 / 8e-106 AT5G08100 489 / 6e-176 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10017879 106 / 9e-28 AT5G08100 157 / 4e-48 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10040935 93 / 6e-21 AT4G00590 484 / 8e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009826 89 / 1e-19 AT4G00590 446 / 2e-156 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Lus10009560 74 / 2e-14 AT5G61540 518 / 0.0 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Lus10020385 68 / 2e-12 AT5G61540 429 / 1e-147 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G022900 520 / 0 AT3G16150 556 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.002G122900 498 / 6e-179 AT3G16150 540 / 0.0 asparaginase B1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1)
Potri.012G063400 313 / 2e-106 AT5G08100 485 / 2e-174 asparaginase A1, N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G080600 78 / 6e-16 AT4G00590 486 / 1e-171 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2)
Potri.014G191900 70 / 2e-13 AT5G61540 497 / 2e-177 N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.1), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.2), N-terminal nucleophile aminohydrolases (Ntn hydrolases) superfamily protein (.3)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0052 NTN PF01112 Asparaginase_2 Asparaginase
Representative CDS sequence
>Lus10024795 pacid=23178856 polypeptide=Lus10024795 locus=Lus10024795.g ID=Lus10024795.BGIv1.0 annot-version=v1.0
ATGGGAGGTTGGGCTATTGCAGTGCACGGTGGCGCTGGGGTGGACCCAAATCTCCCTCAACAGCGACAGGACGAAGCCAAGCTCCTCCTCACTCGCTGCC
TCAATCTCGGCATCTCTTCTCTCCGCTCTCACGATCTCCCCGCCGTCGATGTCGTCGAGCTCGTCGTTCGGGAACTCGAGACCGACCCTCTGTTTAACTC
CGGCCGCGGATCTGCTCTCACCGAGAAAGGTACAGCGGAGATGGAAGCTAGCATCATGGACGGAACCACAAGACGATGCGGAGCCGTTTCTGGCGTTACC
ACCGTGAAGAACCCAGTCTCCCTCGCCCGTCTCGTTATGGAGAAATCCCCTCATTCTTATCTCGCCTTCTCCGGCGCCGAAGCCTTCGCCCGCCAACAGG
GCGTTGAATTGGTGGACAATCATTACTTCATAACAGAGGAGAATCGCGGAATGTTGAAATTGGCTAAGGAAGCCAATTCCATATTGTTCGACTACAGGAT
CCCATTAGCAGAGACATGCAGCGCAGAGGCAGCATCATCAATCGCCAAACCAATAATGATGAACGGACTACCGATCAGCATCTACTCTCCGGAGACGGTG
GGGTGCGTGGTAGTGGACAGTCAAGGCCGGTGTGCCGCCGCCACGTCGACAGGCGGACTAATGAACAAAATGACCGGAAGGATCGGCGACTCCCCGCTGA
TCGGAGCAGGGACGTACGCGGGGAAGCTATGCGGGGTGTCGTGCACAGGGGAAGGGGAGGCGATCATACGCGGAACATTAGCGCGTGACGTGGCGGCGGT
GATGGAGTACAAAGGGCTGAAGCTGCAGGCGGCGGTGGACATGGTGATAAAGGAGAGGCTGGACGACGGCGGACAGGCAGGGCTGATAGCGGTGTCAAAT
GAGGGAGAAGTGGCGTGTGGGTTCAACGCGAATGGGATGTTCAGAGGGTGGGCGAGTGAAGATGGGTTCATGGAAGTTAGGATCTGGTAG
AA sequence
>Lus10024795 pacid=23178856 polypeptide=Lus10024795 locus=Lus10024795.g ID=Lus10024795.BGIv1.0 annot-version=v1.0
MGGWAIAVHGGAGVDPNLPQQRQDEAKLLLTRCLNLGISSLRSHDLPAVDVVELVVRELETDPLFNSGRGSALTEKGTAEMEASIMDGTTRRCGAVSGVT
TVKNPVSLARLVMEKSPHSYLAFSGAEAFARQQGVELVDNHYFITEENRGMLKLAKEANSILFDYRIPLAETCSAEAASSIAKPIMMNGLPISIYSPETV
GCVVVDSQGRCAAATSTGGLMNKMTGRIGDSPLIGAGTYAGKLCGVSCTGEGEAIIRGTLARDVAAVMEYKGLKLQAAVDMVIKERLDDGGQAGLIAVSN
EGEVACGFNANGMFRGWASEDGFMEVRIW

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G16150 ASPGB1 asparaginase B1, N-terminal nu... Lus10024795 0 1
AT1G31260 ZIP10 zinc transporter 10 precursor ... Lus10040615 2.4 0.8705
AT4G16740 ATTPS03 terpene synthase 03 (.1.2) Lus10018500 4.0 0.8956
AT2G18660 AtPNP-A, PNP-A,... plant natriuretic peptide A (.... Lus10030078 6.6 0.8500
AT3G18570 Oleosin family protein (.1) Lus10017992 10.2 0.8642
Lus10016424 10.6 0.8590
AT5G53040 GRD, RKD4 RWP-RK domain-containing 4, GR... Lus10005921 11.1 0.8205
AT1G15190 Fasciclin-like arabinogalactan... Lus10003958 11.4 0.8639
AT2G23790 Protein of unknown function (D... Lus10022496 11.6 0.9027
AT5G62990 EMB1692 embryo defective 1692, Ubiquit... Lus10006104 13.9 0.7599
AT3G16350 MYB Homeodomain-like superfamily p... Lus10037560 21.5 0.8604

Lus10024795 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.