Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G07400 76 / 4e-17 VFB3 VIER F-box proteine 3 (.1) AT1G47056 61 / 4e-12 VFB1 VIER F-box proteine 1 (.1) AT3G50080 52 / 1e-08 VFB2 VIER F-box proteine 2 (.1) AT5G67250 49 / 9e-08 VFB4, SKIP2 VIER F-BOX PROTEINE 4, SKP1/ASK1-interacting protein 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018737 [exp] 187 / 6e-58 AT1G47056 638 / 0.0 VIER F-box proteine 1 (.1) Lus10019319 [exp] 39 / 0.0006 AT5G67250 505 / 3e-176 VIER F-BOX PROTEINE 4, SKP1/ASK1-interacting protein 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G023500 [exp] 118 / 4e-32 AT1G47056 636 / 0.0 VIER F-box proteine 1 (.1) Potri.002G123100 [exp] 96 / 4e-24 AT1G47056 649 / 0.0 VIER F-box proteine 1 (.1) Potri.007G048101 [exp] 72 / 8e-16 AT5G67250 581 / 0.0 VIER F-BOX PROTEINE 4, SKP1/ASK1-interacting protein 2 (.1) Potri.005G141800 [exp] 59 / 3e-11 AT5G67250 570 / 0.0 VIER F-BOX PROTEINE 4, SKP1/ASK1-interacting protein 2 (.1) Potri.006G081600 [exp] 50 / 4e-08 AT4G07400 286 / 3e-89 VIER F-box proteine 3 (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024799 pacid=23178846 polypeptide=Lus10024799 locus=Lus10024799.g ID=Lus10024799.BGIv1.0 annot-version=v1.0 ATGAGAGCTCTAGCAAATGGATGCCCCAATCTGGTGAAAGTGAAGGTAAAGAAATGCAGAGGCGTAACTTGTGATGGCGCAGATTGGTTAAGATCAAGTA GAGAATCACTAGCGGTGAACTTGGATAGCGGTGAAGCAGAACAGCAAGATGCAAACGGTAGCGATGGTGGTGGGGGGCAGGAAAATGGTGTTGAATATCC TCTCGTCCCTAACCAAATTCCTCAAGCACCTTCCATCGGTAATGCATCAGGTAGAACTGCAAGATCAACTTCTTTCAAGGCAAGGATGTTGAGTGGAAGG AGTTTAGTGGCTTGCACTTTGAGAAGATGGTCAAGTGGCAATGGCACTTCTCGGGGCTAA
AA sequence Show only first row Show all	>Lus10024799 pacid=23178846 polypeptide=Lus10024799 locus=Lus10024799.g ID=Lus10024799.BGIv1.0 annot-version=v1.0 MRALANGCPNLVKVKVKKCRGVTCDGADWLRSSRESLAVNLDSGEAEQQDANGSDGGGGQENGVEYPLVPNQIPQAPSIGNASGRTARSTSFKARMLSGR SLVACTLRRWSSGNGTSRG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G07400		VFB3	VIER F-box proteine 3 (.1)		Lus10024799 [exp]	0	1
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Lus10021909 [exp]	10.4	0.8686
AT3G11810			unknown protein		Lus10036797 [exp]	10.7	0.8490
AT5G40190			RNA ligase/cyclic nucleotide p...		Lus10032164 [exp]	14.5	0.7937
AT4G16210		ECHIA, E-COAH-2	ENOYL-COA HYDRATASE 2, enoyl-C...		Lus10016920 [exp]	19.1	0.8508
AT3G15352		ATCOX17	ARABIDOPSIS THALIANA CYTOCHROM...		Lus10037356 [exp]	25.8	0.8435
					Lus10010420 [exp]	27.7	0.7493
AT4G13870		WRNEXO, ATWRNEX...	Werner syndrome-like exonuclea...		Lus10013769 [exp]	28.2	0.8004
AT1G33520		MOS2	modifier of snc1, 2, D111/G-pa...		Lus10004607 [exp]	29.3	0.8279
AT4G27880			Protein with RING/U-box and TR...		Lus10022405 [exp]	31.2	0.8422
AT4G17880	bHLH	bHLH004, MYC4	Basic helix-loop-helix (bHLH) ...		Lus10004575 [exp]	35.7	0.7956

Compare expression of checked genes

Lus10024799 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.