Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37370 209 / 2e-65 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT4G37340 209 / 3e-65 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT1G66540 204 / 6e-65 Cytochrome P450 superfamily protein (.1.2) AT4G37330 203 / 6e-63 CYP81D4 "cytochrome P450, family 81, subfamily D, polypeptide 4", cytochrome P450, family 81, subfamily D, polypeptide 4 (.1) AT4G37360 202 / 2e-62 CYP81D2 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) AT5G67310 194 / 2e-59 CYP81G1 "cytochrome P450, family 81, subfamily G, polypeptide 1", cytochrome P450, family 81, subfamily G, polypeptide 1 (.1) AT3G28740 194 / 4e-59 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT4G37320 192 / 8e-59 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT5G36220 191 / 5e-58 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37430 181 / 3e-54 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018717 [exp] 370 / 1e-127 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024816 [exp] 248 / 7e-80 AT4G37370 506 / 2e-176 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018719 [exp] 227 / 6e-76 AT4G37360 179 / 6e-54 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Lus10020437 [exp] 218 / 1e-68 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10010373 [exp] 209 / 2e-65 AT4G37370 375 / 3e-126 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 204 / 4e-63 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10027614 [exp] 197 / 3e-61 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10018712 [exp] 175 / 3e-54 AT4G37340 279 / 8e-94 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Lus10024819 [exp] 155 / 3e-44 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G007900 [exp] 204 / 3e-63 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007000 [exp] 204 / 4e-63 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G008200 [exp] 203 / 1e-62 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G006000 [exp] 202 / 2e-62 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020500 [exp] 193 / 5e-59 AT4G37370 462 / 2e-159 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G050000 [exp] 189 / 1e-57 AT4G37370 509 / 3e-178 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G020600 [exp] 187 / 9e-57 AT4G37370 479 / 4e-166 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121400 [exp] 186 / 2e-56 AT4G37370 470 / 1e-162 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.008G205200 [exp] 180 / 4e-54 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121100 [exp] 180 / 4e-54 AT4G37370 429 / 2e-146 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10024817 pacid=23178847 polypeptide=Lus10024817 locus=Lus10024817.g ID=Lus10024817.BGIv1.0 annot-version=v1.0 ATGGAGAAAAGGATGTGGAGTGTTCTGGCCAAGTTCGATGGGTTGTTCCAGGGCTTGATTGATGAACGTCGGGATTCTGTTGAGAGAAACAGGGGAGATT TGATTGGGAAGACCATGATTGATAGTTTTCTGAAATTGCAGGAATCTGTTCCTGAAACATATTCAGATGATTTTATCAAAGGCCAGGTGATGTGTCTAAA CCTTCAATCCTTCATCTCCGAGACGCTTCGACTGTATCCAGTAGCACCGCTCTTAGTTCCGCACCACTCTTCAGAGGACTGCACCCTCGAAGACTATCAC ATTCCCAAAGGCACGATGTTAATGGCCAACGCGTGGGCTATTCACAGGGACCCTAATGTCTGGGAGGATCTGACCACTTTTCAACCCGAGAGACATGATG AACGAGTAGGAATGGCGGCTTATGCTTATCAATTGATACCGTTTGGGATGGGAAGAAGGGCATACCCTGGCGCTGGACTTGCGAACCGGGTTGTTAGCTT GGCGTTGGGTGCGTTGATTCAATGCTTTGAATGGGAAAGGGTTGGTGAAGAGTTGTTAGACATGTCTGAAGGTCGAGGGCTTACTATGCCTAAGGTCAAG GCCTTGGAGTCTTTTTGTAAAGCTCAAGAGTGTATGAGAGATAGGGCTTACTATGCCTAA
AA sequence Show only first row Show all	>Lus10024817 pacid=23178847 polypeptide=Lus10024817 locus=Lus10024817.g ID=Lus10024817.BGIv1.0 annot-version=v1.0 MEKRMWSVLAKFDGLFQGLIDERRDSVERNRGDLIGKTMIDSFLKLQESVPETYSDDFIKGQVMCLNLQSFISETLRLYPVAPLLVPHHSSEDCTLEDYH IPKGTMLMANAWAIHRDPNVWEDLTTFQPERHDERVGMAAYAYQLIPFGMGRRAYPGAGLANRVVSLALGALIQCFEWERVGEELLDMSEGRGLTMPKVK ALESFCKAQECMRDRAYYA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37330		CYP81D4	"cytochrome P450, family 81, s...		Lus10024817 [exp]	0	1
AT2G23600		ATMES2, ACL, AT...	ARABIDOPSIS THALIANA METHYL ES...		Lus10012854 [exp]	1.4	1.0000
AT3G04720		HEL, PR-4, PR4	HEVEIN-LIKE, pathogenesis-rela...		Lus10013728 [exp]	2.0	1.0000
AT2G37010		ATNAP12	non-intrinsic ABC protein 12 (...		Lus10023199 [exp]	2.8	0.9631
AT2G46150			Late embryogenesis abundant (L...		Lus10027177 [exp]	3.0	1.0000
					Lus10026928 [exp]	4.0	1.0000
					Lus10040159 [exp]	4.1	0.8867
AT1G12740		CYP87A2	"cytochrome P450, family 87, s...		Lus10005762 [exp]	4.9	0.9854
AT5G42905			Polynucleotidyl transferase, r...		Lus10034950 [exp]	5.2	0.9406
AT1G74100		SOT16, ATSOT16,...	CORONATINE INDUCED-7, ARABIDOP...		Lus10018047 [exp]	5.3	0.9699
AT3G07680			emp24/gp25L/p24 family/GOLD fa...		Lus10006360 [exp]	5.5	0.9881

Compare expression of checked genes

Lus10024817 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.