Lus10024827 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G48540 39 / 0.0004 receptor-like protein kinase-related family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018742 273 / 9e-96 ND 39 / 0.001
Lus10024825 114 / 5e-33 ND /
Lus10012369 38 / 0.001 AT4G11470 42 / 6e-05 cysteine-rich RLK (RECEPTOR-like protein kinase) 31 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G024000 45 / 4e-06 AT4G23180 489 / 4e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023700 45 / 6e-06 AT4G05200 474 / 3e-159 cysteine-rich RLK (RECEPTOR-like protein kinase) 25 (.1)
Potri.004G024140 42 / 9e-05 AT4G23180 497 / 3e-168 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023876 41 / 0.0002 AT4G23180 489 / 5e-165 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
Potri.004G023964 40 / 0.0002 AT4G23180 401 / 6e-132 cysteine-rich RLK (RECEPTOR-like protein kinase) 10 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01657 Stress-antifung Salt stress response/antifungal
Representative CDS sequence
>Lus10024827 pacid=23178980 polypeptide=Lus10024827 locus=Lus10024827.g ID=Lus10024827.BGIv1.0 annot-version=v1.0
ATGGCTTATAACTCTTGCAAACTAGTAGTCCTCATATTCGTCGCTGCCGGCGTGATTCTGCCGCTGGGAACGGCATATGACGGCGACTTTAAGTACTTCG
GATGCAACGAGAAGTCGGGCAAGATTCCGGCGTGCGGCGGTTACGCCAGCGGCATAAAGGAAGCTCTGACCAAAGTGACGGAGTGCACGAAGCCAGGTGT
GTGGGACGGGAGCTGCAAAGTCAAAGTTCCTGATGACTCGGAGAAAGCCAGAGTGTTTGGACATGGGCAGTGCAGGGGTGATGGCGGTAATGTACTGAGG
CTGCCGGTGAAAATGGCGGTCGAGAGTGAGTGCACAGATTGTTTAAAGGCTGCCGCTGGTTACCTTCTTTCCAACTGTAATTATACGGAGGCTGATGTTG
TTTATGATCTATGTTCTATGAGCTACAGCTACAGAGACCTTTGA
AA sequence
>Lus10024827 pacid=23178980 polypeptide=Lus10024827 locus=Lus10024827.g ID=Lus10024827.BGIv1.0 annot-version=v1.0
MAYNSCKLVVLIFVAAGVILPLGTAYDGDFKYFGCNEKSGKIPACGGYASGIKEALTKVTECTKPGVWDGSCKVKVPDDSEKARVFGHGQCRGDGGNVLR
LPVKMAVESECTDCLKAAAGYLLSNCNYTEADVVYDLCSMSYSYRDL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024827 0 1
AT2G39980 HXXXD-type acyl-transferase fa... Lus10029486 2.0 0.5849
AT5G33340 CDR1 CONSTITUTIVE DISEASE RESISTANC... Lus10023445 4.7 0.7091
AT5G07050 nodulin MtN21 /EamA-like trans... Lus10008706 18.8 0.5952
AT3G18170 Glycosyltransferase family 61 ... Lus10032454 22.0 0.5523
AT3G08030 Protein of unknown function, D... Lus10029502 23.5 0.5523
AT5G02070 Protein kinase family protein ... Lus10020667 23.7 0.5744
AT4G02340 alpha/beta-Hydrolases superfam... Lus10038312 24.2 0.5877
AT1G30700 FAD-binding Berberine family p... Lus10031080 24.9 0.5523
Lus10033017 25.9 0.5189
Lus10004437 26.3 0.5523

Lus10024827 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.