Lus10024839 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032337 40 / 0.0003 AT3G42170 839 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.004G126740 39 / 0.0005 AT3G42170 803 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
Potri.004G126780 38 / 0.001 AT3G42170 796 / 0.0 BED zinc finger ;hAT family dimerisation domain (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0361 C2H2-zf PF02892 zf-BED BED zinc finger
Representative CDS sequence
>Lus10024839 pacid=23178958 polypeptide=Lus10024839 locus=Lus10024839.g ID=Lus10024839.BGIv1.0 annot-version=v1.0
ATGGAGAATACTGGCAGCATCGAATCGAACTCCCCGCCACCTGCTCCTCAACGAGCAGGTGGAGTGGTATTCGTAGACGGACCTGGAATTGCAGATGCAA
AGAAGAGGACGAGGGCAGACGTGTGGGATCACTTTGAAATCGCATTCGTCGAACAGGGAAACCCTAAGAAGACGATCCGGAAGGGCAAATGCAAGCACTG
CAATACTCTGATCGCTACTGATTCGAGACTGAACGGTACTTCCAGCTTGAGGAGGCATGTTGAGCGGCATTGTCATGCTATTGGTGCCAATGCTAGCAGA
GATGTTCATGGTAGTTGTAACAATGCTTGTGGGAAAATGGTGGTTAAGAAGCCTAAGATCAATAGTCATCTGACGATTCTGAATTACTTCCGTCCTAACT
CGGTTAGGCTTAAGCTTTGA
AA sequence
>Lus10024839 pacid=23178958 polypeptide=Lus10024839 locus=Lus10024839.g ID=Lus10024839.BGIv1.0 annot-version=v1.0
MENTGSIESNSPPPAPQRAGGVVFVDGPGIADAKKRTRADVWDHFEIAFVEQGNPKKTIRKGKCKHCNTLIATDSRLNGTSSLRRHVERHCHAIGANASR
DVHGSCNNACGKMVVKKPKINSHLTILNYFRPNSVRLKL

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10024839 0 1
AT1G10200 LIM WLIM1, SF3 WLIM1, GATA type zinc finger t... Lus10027305 30.6 0.6053
AT5G25570 unknown protein Lus10007669 35.8 0.5964
AT5G48390 ATZIP4 Tetratricopeptide repeat (TPR)... Lus10043032 59.6 0.5248
AT1G13290 C2H2ZnF WIP6, DOT5 WIP domain protein 6, DEFECTIV... Lus10035044 63.6 0.5859
AT1G07020 unknown protein Lus10026396 89.2 0.5295
AT1G60630 Leucine-rich repeat protein ki... Lus10019429 93.0 0.5793
Lus10017181 104.3 0.5555
Lus10008817 126.2 0.5758
AT3G28345 MDR13, ABCB15 multi-drug resistance 13, ATP-... Lus10036616 136.7 0.5286
AT3G10660 ATCPK2, CPK2 calmodulin-domain protein kina... Lus10016190 188.1 0.5333

Lus10024839 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.