Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43700 211 / 8e-70 AUX_IAA IAA4, ATAUX2-11 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) AT1G04240 210 / 2e-69 AUX_IAA IAA3, SHY2 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) AT3G23030 185 / 1e-59 AUX_IAA IAA2 indole-3-acetic acid inducible 2 (.1) AT4G14560 183 / 6e-59 AUX_IAA AXR5, IAA1 AUXIN RESISTANT 5, indole-3-acetic acid inducible (.1) AT3G04730 166 / 2e-51 AUX_IAA IAA16 indoleacetic acid-induced protein 16 (.1) AT1G04250 166 / 3e-51 AUX_IAA IAA17, AXR3 indole-3-acetic acid inducible 17, AUXIN RESISTANT 3, AUX/IAA transcriptional regulator family protein (.1) AT3G23050 166 / 3e-51 AUX_IAA AXR2, IAA7 AUXIN RESISTANT 2, indole-3-acetic acid 7 (.1.2) AT4G14550 160 / 3e-49 AUX_IAA SLR, IAA14 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) AT4G29080 157 / 3e-47 AUX_IAA IAA27, PAP2 indole-3-acetic acid inducible 27, phytochrome-associated protein 2 (.1) AT3G15540 145 / 1e-43 AUX_IAA MSG2, IAA19 MASSUGU 2, indole-3-acetic acid inducible 19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018764 [exp] 366 / 3e-130 AT5G43700 210 / 4e-69 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10014729 [exp] 283 / 1e-97 AT1G04240 230 / 2e-77 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10002723 [exp] 281 / 4e-97 AT5G43700 221 / 4e-74 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10039413 [exp] 222 / 1e-73 AT1G04240 250 / 2e-85 SHORT HYPOCOTYL 2, indole-3-acetic acid inducible 3, AUX/IAA transcriptional regulator family protein (.1) Lus10039488 [exp] 217 / 7e-72 AT5G43700 247 / 3e-84 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Lus10028222 [exp] 168 / 2e-51 AT5G65670 322 / 3e-110 indole-3-acetic acid inducible 9 (.1.2) Lus10039414 [exp] 167 / 3e-51 AT4G14550 305 / 1e-105 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Lus10042929 [exp] 152 / 2e-44 AT5G65670 356 / 3e-122 indole-3-acetic acid inducible 9 (.1.2) Lus10019241 [exp] 148 / 2e-43 AT5G65670 356 / 4e-123 indole-3-acetic acid inducible 9 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218200 [exp] 251 / 3e-85 AT5G43700 243 / 2e-82 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.002G045000 [exp] 246 / 2e-83 AT5G43700 236 / 5e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.005G053800 [exp] 229 / 2e-76 AT5G43700 239 / 7e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.013G041300 [exp] 228 / 4e-76 AT5G43700 239 / 5e-81 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.010G078400 [exp] 207 / 4e-68 AT5G43700 248 / 9e-85 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161100 [exp] 207 / 2e-67 AT5G43700 238 / 3e-80 indole-3-acetic acid inducible 4, AUXIN INDUCIBLE 2-11, AUX/IAA transcriptional regulator family protein (.1) Potri.008G161200 [exp] 170 / 7e-53 AT4G14550 343 / 1e-120 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.002G044900 [exp] 165 / 5e-51 AT4G14550 286 / 1e-98 SOLITARY ROOT, indole-3-acetic acid inducible 14 (.1) Potri.013G041400 [exp] 165 / 8e-51 AT3G04730 306 / 6e-106 indoleacetic acid-induced protein 16 (.1) Potri.001G177400 [exp] 159 / 5e-49 AT3G04730 211 / 8e-69 indoleacetic acid-induced protein 16 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [flax] [poplar] Ubiquitin PF02309 [flax] [poplar] AUX_IAA AUX/IAA family
Representative CDS sequence Show only first row Show all	>Lus10024853 pacid=23178858 polypeptide=Lus10024853 locus=Lus10024853.g ID=Lus10024853.BGIv1.0 annot-version=v1.0 ATGGAAAGATCATCATCTACGGAGCACATGGCTTCCGATCTCAACCTCAAGGCCACAGAGCTCCGATTAGGATTGCCAGGAAGCGACAGCCGCGACGAGC CTGAGAAATCACAGGCCAGCAGCACTTCCCCGACGACAACGCCAACTCTACTAAGAACTGGCATCATCATCAGCAACAACAACAAGAGATCCTCGCCGGA AGTGCCAGTCGACGAGTGCAAGTCGCAGAGCAATTCCAGCGCCTCCGATGTCGAGGATGGCGACGGCGATTGCGCTCATCCTCCCGCTAAAGCACAAGCG GTGGGATGGCCTCCGATCCGATCGTACAGGAAGAGCTGCTTCGAGCAGAAGAAGAAGAAGAAGAAGAGCGAGTACGTGAAAGTGAGCATGGACGGAGCTC CGTACCTGCGCAAGATAGACGTGAAGATGTACAAGAGCTATTACGAGCTGCTGAGTGGTTTGGAGAGCATGTTCAAGCTCAAGTTCGGGGAGTACTCGGA GAGGGAAGGATACAACGGATCTGATTTCGCTCCGACTTACGAGGACAAGGACGGCGACTGGATGCTGGTCGGAGATGTGCCGTGGGAGATGTTCATCGGA TCCTGCAAGAGGTTGAGGATAATGAGGGGATCCGAAGCTAGAGGGCTCGGTTGCATATAA
AA sequence Show only first row Show all	>Lus10024853 pacid=23178858 polypeptide=Lus10024853 locus=Lus10024853.g ID=Lus10024853.BGIv1.0 annot-version=v1.0 MERSSSTEHMASDLNLKATELRLGLPGSDSRDEPEKSQASSTSPTTTPTLLRTGIIISNNNKRSSPEVPVDECKSQSNSSASDVEDGDGDCAHPPAKAQA VGWPPIRSYRKSCFEQKKKKKKSEYVKVSMDGAPYLRKIDVKMYKSYYELLSGLESMFKLKFGEYSEREGYNGSDFAPTYEDKDGDWMLVGDVPWEMFIG SCKRLRIMRGSEARGLGCI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G04240	AUX_IAA	IAA3, SHY2	SHORT HYPOCOTYL 2, indole-3-ac...		Lus10024853 [exp]	0	1
AT4G14550	AUX_IAA	SLR, IAA14	SOLITARY ROOT, indole-3-acetic...		Lus10039487 [exp]	1.0	0.9330
AT4G38840			SAUR-like auxin-responsive pro...		Lus10038193 [exp]	2.8	0.9059
AT5G43700	AUX_IAA	IAA4, ATAUX2-11	indole-3-acetic acid inducible...		Lus10018764 [exp]	3.5	0.9330
AT5G18020			SAUR-like auxin-responsive pro...		Lus10039020 [exp]	5.0	0.8952
AT2G23970			Class I glutamine amidotransfe...		Lus10033793 [exp]	6.0	0.8008
AT5G23160			unknown protein		Lus10013437 [exp]	6.7	0.9212
AT4G38840			SAUR-like auxin-responsive pro...		Lus10025910 [exp]	7.1	0.8585
					Lus10038294 [exp]	8.5	0.8641
AT5G45670			GDSL-like Lipase/Acylhydrolase...		Lus10002777 [exp]	9.9	0.8678
AT2G21140		ATPRP2	proline-rich protein 2 (.1)		Lus10042392 [exp]	10.4	0.8898

Compare expression of checked genes

Lus10024853 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.