Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G30570 74 / 7e-18 PSBW photosystem II reaction center W (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014751 [exp] 96 / 4e-26 AT2G30570 134 / 3e-41 photosystem II reaction center W (.1) Lus10033862 [exp] 93 / 5e-25 AT2G30570 137 / 2e-42 photosystem II reaction center W (.1) Lus10018771 [exp] 80 / 5e-21 AT2G30570 100 / 2e-29 photosystem II reaction center W (.1) Lus10018772 [exp] 68 / 7e-16 ND 34 / 0.004
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G218800 [exp] 93 / 4e-25 AT2G30570 113 / 3e-33 photosystem II reaction center W (.1) Potri.002G044300 [exp] 92 / 1e-24 AT2G30570 120 / 8e-36 photosystem II reaction center W (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07123 [flax] [poplar] PsbW Photosystem II reaction centre W protein (PsbW)
Representative CDS sequence Show only first row Show all	>Lus10024858 pacid=23178910 polypeptide=Lus10024858 locus=Lus10024858.g ID=Lus10024858.BGIv1.0 annot-version=v1.0 ATGGCGTCAATCTCAGCTGCAACCACCGCCACATCCTTCGTCAACTCCCCACTTCGTCACAAGCCTTCCCTATCCATCTCTTCCTCCTCTGTCCTCGGTC TGCCGGCGATGGAGAAGAAAGGGAGACTGGTGGTGAAGTGCTCTGCGGAAGGAAAAGGTAGCAGCATGGGCGCTTCGGTGATGGCGGCGGCCACAGCGGC GGCGGTTTCGAGCCCGGCGGCGATGGCGCTTGTGGACGTCAGGATGAGCACGGAAGGAACTGGGCTGCCGTTCGGGTTGAGCAACAACCTACTCGGGTGG ATCCTTTTGGGTGTGTTCGGACTCATCTGGTCTCTCTACACTGTGTACACCTCGGATCTTGAGGAGGACGAGGAGTCCGGTTTGTCTCTTTGA
AA sequence Show only first row Show all	>Lus10024858 pacid=23178910 polypeptide=Lus10024858 locus=Lus10024858.g ID=Lus10024858.BGIv1.0 annot-version=v1.0 MASISAATTATSFVNSPLRHKPSLSISSSSVLGLPAMEKKGRLVVKCSAEGKGSSMGASVMAAATAAAVSSPAAMALVDVRMSTEGTGLPFGLSNNLLGW ILLGVFGLIWSLYTVYTSDLEEDEESGLSL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G30570		PSBW	photosystem II reaction center...		Lus10024858 [exp]	0	1
AT1G55670		PSAG	photosystem I subunit G (.1)		Lus10017476 [exp]	2.6	0.9535
AT3G12345			unknown protein		Lus10023468 [exp]	2.8	0.9474
AT2G30570		PSBW	photosystem II reaction center...		Lus10018771 [exp]	4.5	0.9431
AT3G50820		OEC33, PSBO2, P...	OXYGEN EVOLVING COMPLEX SUBUNI...		Lus10016783 [exp]	4.9	0.9518
					Lus10018772 [exp]	4.9	0.9507
AT4G12830			alpha/beta-Hydrolases superfam...		Lus10008747 [exp]	5.5	0.9519
AT2G26500			cytochrome b6f complex subunit...		Lus10011665 [exp]	5.9	0.9504
AT3G21870		CYCP2;1	cyclin p2;1 (.1)		Lus10039697 [exp]	6.5	0.9392
AT1G54500			Rubredoxin-like superfamily pr...		Lus10019005 [exp]	7.0	0.9475
AT1G66130			NAD(P)-binding Rossmann-fold s...		Lus10002180 [exp]	7.9	0.9458

Compare expression of checked genes

Lus10024858 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.