Lus10024862 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G49100 194 / 2e-65 Signal recognition particle, SRP9/SRP14 subunit (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10018775 270 / 1e-94 AT3G49100 194 / 2e-65 Signal recognition particle, SRP9/SRP14 subunit (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G043600 187 / 1e-62 AT3G49100 199 / 5e-68 Signal recognition particle, SRP9/SRP14 subunit (.1)
Potri.005G219400 185 / 7e-62 AT3G49100 177 / 3e-59 Signal recognition particle, SRP9/SRP14 subunit (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0623 SRP9_14 PF05486 SRP9-21 Signal recognition particle 9 kDa protein (SRP9)
Representative CDS sequence
>Lus10024862 pacid=23178844 polypeptide=Lus10024862 locus=Lus10024862.g ID=Lus10024862.BGIv1.0 annot-version=v1.0
ATGCTACTGTTTCAACAAGAATTTGACTGCGGGAATTTTGTTTTTGACAGCAGCTGGGAGATTGTTGTTGAGTTTCTCTCTATCTCTGTTCACTGTGGTT
CACGACCAATGGTTTACATTACTTCCTGGGACGAGTTTGCGGAGCGAACGCTGCAGATGTTCCGTGCCGATCCAGACTCGACTCGGTACGTTATGAAGTA
CAGACATAGTGAAGGCAAGCTGGTTCTCAAGGTTACTGACAACAAAGAGTGCCTCAAGTTTAAGACAGACCAGGCACAAGAGGCTAAGAAGATGGAAAAG
CTAAATAACTTGTTCTTCACACTGATGGCTCGTGGTCCTGACGCGGATGTATCAGAAGTTGCAGGAAAAGAGCAGATGGATACACAGCCAGCAAAGAAAG
GAAGGGGCCGTAAGCAATGA
AA sequence
>Lus10024862 pacid=23178844 polypeptide=Lus10024862 locus=Lus10024862.g ID=Lus10024862.BGIv1.0 annot-version=v1.0
MLLFQQEFDCGNFVFDSSWEIVVEFLSISVHCGSRPMVYITSWDEFAERTLQMFRADPDSTRYVMKYRHSEGKLVLKVTDNKECLKFKTDQAQEAKKMEK
LNNLFFTLMARGPDADVSEVAGKEQMDTQPAKKGRGRKQ

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT3G49100 Signal recognition particle, S... Lus10024862 0 1
AT3G49100 Signal recognition particle, S... Lus10018775 4.5 0.8776
AT4G33250 ATTIF3K1, EIF3K eukaryotic translation initiat... Lus10039931 12.2 0.8522
AT3G18760 Translation elongation factor... Lus10006729 17.7 0.8402
AT2G07340 PFD1 PREFOLDIN 1 (.1.2) Lus10021609 18.4 0.7754
AT4G14320 Zinc-binding ribosomal protein... Lus10038130 18.9 0.8620
AT5G50810 TIM8 translocase inner membrane sub... Lus10022450 22.8 0.8474
AT2G34520 RPS14 mitochondrial ribosomal protei... Lus10034657 23.2 0.8380
AT1G52600 Peptidase S24/S26A/S26B/S26C f... Lus10023131 23.5 0.8237
AT5G49510 PFD3, PDF3 prefoldin 3 (.1.2) Lus10011145 24.2 0.8357
AT2G20450 Ribosomal protein L14 (.1) Lus10008246 25.7 0.8469

Lus10024862 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.