Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020348 [exp] 65 / 2e-13 AT5G35930 526 / 4e-172 AMP-dependent synthetase and ligase family protein (.1) Lus10009528 [exp] 63 / 1e-12 AT5G35930 1051 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G043800 [exp] 51 / 1e-08 AT5G35930 1127 / 0.0 AMP-dependent synthetase and ligase family protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024863 pacid=23178934 polypeptide=Lus10024863 locus=Lus10024863.g ID=Lus10024863.BGIv1.0 annot-version=v1.0 ATGATTGACAAAGTTCCTCTAGCCATGTTCCCTAACAACTTCACGGTGGTCATATCATTACCCATTTATTCCATTGGTAAAGTTGATTATTCTTCATTGG AGAGTTCTACTGGTTCATCCGAGCATGATCAGGCTGAGGATGGCAGTTCTATCAGCAATGGCCTCTCTTGCATGTTATCAAGAAGAGCGAACTGTGGTAA AAACCGTTACAACACTATCTTGGCACAACATCGAGCCAATCTATGGAGAGCGAGCGAACGTGTACTTCAGGCCACCCGATATGCTCTTTGGTTGAAATGG CGGTGGGTGAAGCGTAGCTTGATAGTCTGA
AA sequence Show only first row Show all	>Lus10024863 pacid=23178934 polypeptide=Lus10024863 locus=Lus10024863.g ID=Lus10024863.BGIv1.0 annot-version=v1.0 MIDKVPLAMFPNNFTVVISLPIYSIGKVDYSSLESSTGSSEHDQAEDGSSISNGLSCMLSRRANCGKNRYNTILAQHRANLWRASERVLQATRYALWLKW RWVKRSLIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024863 [exp]	0	1
					Lus10022950 [exp]	3.7	0.7643
AT5G03050			unknown protein		Lus10012904 [exp]	4.9	0.7340
					Lus10027768 [exp]	5.5	0.6756
					Lus10020274 [exp]	8.7	0.7541
AT5G28540		BIP1	heat shock protein 70 (Hsp 70)...		Lus10029103 [exp]	13.2	0.8055
AT3G15720			Pectin lyase-like superfamily ...		Lus10040604 [exp]	15.9	0.7120
AT3G18200			nodulin MtN21 /EamA-like trans...		Lus10021200 [exp]	19.1	0.7273
AT2G38910		CPK20	calcium-dependent protein kina...		Lus10029346 [exp]	26.6	0.7482
AT5G38760			Late embryogenesis abundant pr...		Lus10026292 [exp]	29.9	0.7619
AT5G44440			FAD-binding Berberine family p...		Lus10003646 [exp]	37.0	0.6711

Compare expression of checked genes

Lus10024863 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.