Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G09500 222 / 3e-76 Ribosomal protein S19 family protein (.1) AT5G09510 213 / 4e-73 Ribosomal protein S19 family protein (.1.2) AT1G04270 212 / 4e-72 RPS15 cytosolic ribosomal protein S15 (.1.2) AT5G09490 210 / 2e-71 Ribosomal protein S19 family protein (.1) AT5G43640 196 / 3e-66 Ribosomal protein S19 family protein (.1) AT5G63070 156 / 4e-50 Ribosomal protein S19 family protein (.1) ATCG00820 44 / 6e-07 ATCG00820.1, RPS19 ribosomal protein S19 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018777 [exp] 242 / 5e-84 AT5G09510 266 / 3e-93 Ribosomal protein S19 family protein (.1.2) Lus10033856 [exp] 241 / 8e-84 AT5G09510 265 / 9e-93 Ribosomal protein S19 family protein (.1.2) Lus10041168 [exp] 235 / 1e-79 AT5G09510 260 / 6e-89 Ribosomal protein S19 family protein (.1.2) Lus10007469 [exp] 227 / 3e-78 AT5G09500 250 / 6e-87 Ribosomal protein S19 family protein (.1) Lus10021886 [exp] 219 / 3e-72 AT5G09500 244 / 1e-81 Ribosomal protein S19 family protein (.1) Lus10026127 [exp] 208 / 2e-70 AT5G09500 244 / 4e-84 Ribosomal protein S19 family protein (.1) Lus10008692 [exp] 139 / 1e-43 AT5G09490 162 / 2e-52 Ribosomal protein S19 family protein (.1) Lus10027711 [exp] 42 / 9e-06 AT5G47320 123 / 3e-36 ribosomal protein S19 (.1) Lus10003009 [exp] 42 / 5e-05 AT5G47040 1420 / 0.0 lon protease 2 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G076900 [exp] 233 / 2e-80 AT5G09510 267 / 2e-93 Ribosomal protein S19 family protein (.1.2) Potri.002G043200 [exp] 229 / 3e-79 AT5G09500 266 / 5e-93 Ribosomal protein S19 family protein (.1) Potri.005G219700 [exp] 229 / 7e-79 AT5G09500 266 / 6e-93 Ribosomal protein S19 family protein (.1) Potri.008G161901 [exp] 130 / 4e-41 AT5G09510 130 / 4e-41 Ribosomal protein S19 family protein (.1.2) Potri.005G055401 [exp] 94 / 1e-26 AT1G04270 97 / 3e-27 cytosolic ribosomal protein S15 (.1.2) Potri.005G055534 [exp] 75 / 2e-18 AT1G04270 77 / 1e-18 cytosolic ribosomal protein S15 (.1.2) Potri.003G123750 [exp] 66 / 1e-15 AT1G04270 67 / 4e-16 cytosolic ribosomal protein S15 (.1.2) Potri.013G137688 [exp] 44 / 1e-06 ATCG00820 169 / 1e-56 ribosomal protein S19 (.1) Potri.011G074301 [exp] 44 / 1e-06 ATCG00820 168 / 2e-56 ribosomal protein S19 (.1) Potri.005G154674 [exp] 44 / 1e-06 ATCG00820 167 / 9e-56 ribosomal protein S19 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00203 [flax] [poplar] Ribosomal_S19 Ribosomal protein S19
Representative CDS sequence Show only first row Show all	>Lus10024865 pacid=23178992 polypeptide=Lus10024865 locus=Lus10024865.g ID=Lus10024865.BGIv1.0 annot-version=v1.0 ATGTCCACTGATGACCTCGTCAAGCTCTTCACTGCTCGTGCTCGTAGAAGGTTCCAGCGAGGTTTGACTAGGAAGCCAATGGCACTTGTTAAGAAGCTCC GCAAGGCTAAAAGAGAGGCTCCAGCTGGTGAGAAACCCGAGCCAGTCCGTACCCACCTCAGAAACATGATCATCGTCCCCGAGATGATTGGCAGCGTCAT CGGTGTTTACAACGGAAAGACATTCAACCAAGTCGAGATCAAGCCCGAGATGATTGGACATTACCTAGCCGAGTTCTCTATCAGCTACAAGCCTGTGAAG CACGGAAGACCCGGTATCGGTGCTACTCACTCTTCCAGGTTCATCCCCCTCAAGTGA
AA sequence Show only first row Show all	>Lus10024865 pacid=23178992 polypeptide=Lus10024865 locus=Lus10024865.g ID=Lus10024865.BGIv1.0 annot-version=v1.0 MSTDDLVKLFTARARRRFQRGLTRKPMALVKKLRKAKREAPAGEKPEPVRTHLRNMIIVPEMIGSVIGVYNGKTFNQVEIKPEMIGHYLAEFSISYKPVK HGRPGIGATHSSRFIPLK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G09500			Ribosomal protein S19 family p...		Lus10024865 [exp]	0	1
AT4G36130			Ribosomal protein L2 family (....		Lus10041923 [exp]	2.8	0.9515
AT1G74050			Ribosomal protein L6 family pr...		Lus10038776 [exp]	2.8	0.9423
AT3G57490			Ribosomal protein S5 family pr...		Lus10009952 [exp]	3.0	0.9434
AT5G48760			Ribosomal protein L13 family p...		Lus10007137 [exp]	4.2	0.9470
AT5G40770		ATPHB3	prohibitin 3 (.1)		Lus10032072 [exp]	5.5	0.9211
AT1G33140		PGY2	PIGGYBACK2, Ribosomal protein ...		Lus10032918 [exp]	6.7	0.9401
AT4G20020			unknown protein		Lus10035806 [exp]	7.1	0.9104
AT5G09510			Ribosomal protein S19 family p...		Lus10018777 [exp]	7.5	0.8932
AT3G05590		RPL18	ribosomal protein L18 (.1)		Lus10031485 [exp]	7.7	0.9356
AT1G07940			GTP binding Elongation factor ...		Lus10023174 [exp]	8.5	0.9204

Compare expression of checked genes

Lus10024865 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.