Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT2G38900 57 / 2e-12 Serine protease inhibitor, potato inhibitor I-type family protein (.1.2) AT5G43580 55 / 2e-11 UPI UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT3G46860 44 / 3e-07 Serine protease inhibitor, potato inhibitor I-type family protein (.1) AT5G43570 40 / 7e-06 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018786 [exp] 112 / 2e-34 AT2G38870 93 / 6e-27 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018784 [exp] 74 / 2e-19 AT2G38870 89 / 1e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10014740 [exp] 74 / 2e-19 AT2G38870 77 / 2e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10002732 [exp] 72 / 2e-18 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10018783 [exp] 67 / 2e-16 AT2G38870 89 / 2e-25 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Lus10043097 [exp] 46 / 3e-07 AT1G52870 505 / 2e-179 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2) Lus10032655 [exp] 45 / 4e-07 AT1G52870 499 / 3e-176 Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.1), Peroxisomal membrane 22 kDa (Mpv17/PMP22) family protein (.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G042300 [exp] 76 / 5e-20 AT2G38870 68 / 5e-17 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075400 [exp] 64 / 3e-15 AT2G38870 84 / 3e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G079050 [exp] 62 / 2e-14 AT2G38870 81 / 2e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G078900 [exp] 61 / 2e-14 AT2G38870 84 / 2e-23 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075600 [exp] 59 / 1e-13 AT5G43580 80 / 3e-21 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.006G212200 [exp] 59 / 1e-13 AT2G38870 81 / 6e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.010G075200 [exp] 59 / 2e-13 AT2G38870 76 / 4e-20 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.006G212000 [exp] 57 / 6e-13 AT2G38870 81 / 5e-22 Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.009G028300 [exp] 56 / 2e-12 AT5G43580 76 / 7e-20 UNUSUAL SERINE PROTEASE INHIBITOR, Serine protease inhibitor, potato inhibitor I-type family protein (.1) Potri.016G078800 [exp] 56 / 2e-12 AT2G38870 79 / 3e-21 Serine protease inhibitor, potato inhibitor I-type family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0367 [flax] [poplar] CI-2 PF00280 [flax] [poplar] potato_inhibit Potato inhibitor I family
Representative CDS sequence Show only first row Show all	>Lus10024870 pacid=23178945 polypeptide=Lus10024870 locus=Lus10024870.g ID=Lus10024870.BGIv1.0 annot-version=v1.0 ATGTCGTCGTCTGAGTGTCCAGGGAAGAACTCATGGCCGGAGCTGGTGGGGAGGAACGGGGACGAAGCGGCTGCGGTGATTGAGAGACAGAACAGGAGGG TGGACGCCATCGTGCTGCTGGAAGGGACCCCAACGACGAGGGATTTCAGGTGCGACAGGGTCTGGGTTTGGGTTAACGACGACAGGGTTGTCATCCGTGC TCCTCGCGCTGGTTAA
AA sequence Show only first row Show all	>Lus10024870 pacid=23178945 polypeptide=Lus10024870 locus=Lus10024870.g ID=Lus10024870.BGIv1.0 annot-version=v1.0 MSSSECPGKNSWPELVGRNGDEAAAVIERQNRRVDAIVLLEGTPTTRDFRCDRVWVWVNDDRVVIRAPRAG

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G38870			Serine protease inhibitor, pot...		Lus10024870 [exp]	0	1
AT3G45140		ATLOX2, LOX2	ARABIODOPSIS THALIANA LIPOXYGE...		Lus10031810 [exp]	1.7	0.9539
AT1G73260		ATKTI1	ARABIDOPSIS THALIANA KUNITZ TR...		Lus10029429 [exp]	2.0	0.9289
AT3G50120			Plant protein of unknown funct...		Lus10006802 [exp]	4.2	0.8708
AT1G78410			VQ motif-containing protein (....		Lus10023308 [exp]	9.3	0.9213
AT2G40740	WRKY	ATWRKY55, WRKY5...	WRKY DNA-binding protein 55 (....		Lus10034245 [exp]	11.8	0.8906
AT5G39110			RmlC-like cupins superfamily p...		Lus10035293 [exp]	13.7	0.8297
AT3G07960		PIP5K6	phosphatidylinositol-4-phospha...		Lus10039507 [exp]	14.2	0.8536
AT2G38870			Serine protease inhibitor, pot...		Lus10018784 [exp]	17.7	0.8357
AT1G01490			Heavy metal transport/detoxifi...		Lus10024672 [exp]	19.4	0.8032
					Lus10041755 [exp]	21.0	0.7962

Compare expression of checked genes

Lus10024870 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.