Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G06135 37 / 0.0003 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000703 [exp] 107 / 1e-31 AT1G06135 44 / 3e-07 unknown protein Lus10024872 [exp] 100 / 3e-28 ND 39 / 3e-05 Lus10014739 [exp] 67 / 2e-15 ND 40 / 2e-05
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G043600 [exp] 47 / 1e-07 AT1G06135 39 / 3e-05 unknown protein Potri.005G221200 [exp] 44 / 1e-06 AT2G31335 / unknown protein Potri.019G013000 [exp] 42 / 1e-05 AT2G31335 / unknown protein Potri.008G163000 [exp] 38 / 0.0001 AT2G31335 40 / 1e-05 unknown protein Potri.010G075100 [exp] 38 / 0.0001 ND /
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024873 pacid=23178834 polypeptide=Lus10024873 locus=Lus10024873.g ID=Lus10024873.BGIv1.0 annot-version=v1.0 ATGGGTTTTGTGTCTCCAAGGAAGATGATGATCATTTTGGTTATGGTTATGGTTCTTCTCTCGGCTTCGGTTTTCCAGCCTGCTGAAACGAGACCACTGA AGCAAGAATATAATATTGGTGGTAATAATGGTCACGATTTACCACTCCTACAGTCTCTGCAGAAGGGTCCGGTTCAAGGGTCGGGTCCAAACCCGTGCAC CAACATCGGCGGCCGGAACCCGGGATCCTGCACCCGTGCGGCTGTTGGTGCCATGAACTTCGCCGGCATCAATGTCTCAGTCCGACCGCCGCATGCTCCT CCTATAGCTGTTGTCGCAGCTGATAAATAG
AA sequence Show only first row Show all	>Lus10024873 pacid=23178834 polypeptide=Lus10024873 locus=Lus10024873.g ID=Lus10024873.BGIv1.0 annot-version=v1.0 MGFVSPRKMMIILVMVMVLLSASVFQPAETRPLKQEYNIGGNNGHDLPLLQSLQKGPVQGSGPNPCTNIGGRNPGSCTRAAVGAMNFAGINVSVRPPHAP PIAVVAADK

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024873 [exp]	0	1
AT4G36220		CYP84A1, FAH1, ...	ferulic acid 5-hydroxylase 1 (...		Lus10034300 [exp]	2.2	0.9766
AT5G62020	HSF	AT-HSFB2A	ARABIDOPSIS THALIANA HEAT SHOC...		Lus10011185 [exp]	2.6	0.9809
AT5G52400		CYP715A1	"cytochrome P450, family 715, ...		Lus10027480 [exp]	2.8	0.9767
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Lus10016720 [exp]	3.7	0.9799
AT4G23690			Disease resistance-responsive ...		Lus10024714 [exp]	6.9	0.9783
AT3G11840		PUB24	plant U-box 24 (.1)		Lus10029395 [exp]	7.7	0.9627
					Lus10021010 [exp]	7.9	0.9638
AT1G14205			Ribosomal L18p/L5e family prot...		Lus10030465 [exp]	8.5	0.9577
AT1G14205			Ribosomal L18p/L5e family prot...		Lus10012820 [exp]	10.6	0.9602
AT5G14040		PHT3;1	phosphate transporter 3;1 (.1)		Lus10036014 [exp]	11.5	0.9757

Compare expression of checked genes

Lus10024873 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.