Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G37740 57 / 4e-10 C2H2ZnF ATZFP10, ZFP10 zinc-finger protein 10 (.1) AT4G17810 56 / 5e-10 C2H2ZnF ZFP12 C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G23130 55 / 1e-09 C2H2ZnF FLO10, FON1, SUP SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) AT3G53820 53 / 2e-09 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT2G42410 54 / 3e-09 C2H2ZnF ATZFP11, ZFP11 zinc finger protein 11 (.1) AT3G09290 53 / 4e-09 C2H2ZnF TAC1 telomerase activator1 (.1) AT5G06070 53 / 7e-09 C2H2ZnF RAB, RBE RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G43540 48 / 2e-07 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G01860 45 / 5e-06 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1) AT5G27880 45 / 8e-06 C2H2ZnF C2H2 and C2HC zinc fingers superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10000705 [exp] 154 / 4e-48 AT2G37740 66 / 2e-13 zinc-finger protein 10 (.1) Lus10021490 [exp] 56 / 1e-09 AT2G37740 103 / 1e-25 zinc-finger protein 10 (.1) Lus10024362 [exp] 56 / 1e-09 AT2G37740 105 / 4e-27 zinc-finger protein 10 (.1) Lus10004705 [exp] 55 / 2e-09 AT2G37740 100 / 1e-25 zinc-finger protein 10 (.1) Lus10010871 [exp] 55 / 2e-09 AT2G37740 103 / 9e-26 zinc-finger protein 10 (.1) Lus10030967 [exp] 54 / 3e-09 AT4G17810 112 / 1e-30 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10040083 [exp] 54 / 4e-09 AT4G17810 123 / 8e-35 C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10021215 [exp] 54 / 5e-09 AT3G23130 102 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Lus10022206 [exp] 54 / 6e-09 AT3G23130 100 / 1e-25 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G041700 [exp] 57 / 2e-10 AT2G42410 105 / 3e-28 zinc finger protein 11 (.1) Potri.001G142900 [exp] 56 / 7e-10 AT4G17810 135 / 1e-39 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.003G091200 [exp] 56 / 9e-10 AT4G17810 140 / 2e-41 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G089600 [exp] 56 / 1e-09 AT2G37740 102 / 2e-25 zinc-finger protein 10 (.1) Potri.016G101400 [exp] 55 / 2e-09 AT2G37740 108 / 3e-27 zinc-finger protein 10 (.1) Potri.008G163900 [exp] 54 / 3e-09 AT3G23130 119 / 1e-33 SUPERMAN, FLORAL ORGAN NUMBER 1, FLORAL DEFECTIVE 10, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.006G089301 [exp] 53 / 4e-09 AT3G53820 96 / 1e-25 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.016G101300 [exp] 53 / 4e-09 AT3G53820 92 / 2e-24 C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.008G059000 [exp] 54 / 6e-09 AT5G06070 99 / 2e-24 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1) Potri.010G199800 [exp] 53 / 1e-08 AT5G06070 100 / 4e-25 RABBIT EARS, C2H2 and C2HC zinc fingers superfamily protein (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024875 pacid=23178996 polypeptide=Lus10024875 locus=Lus10024875.g ID=Lus10024875.BGIv1.0 annot-version=v1.0 ATGGAGAAGACATGCAGAACCAGAACCAAACCCCGGGATCCTCATCCTCATCACCGGTCATGGTACGTGTGCAACTTCTGCAGGAAAGACTTCAGCTCGG CTCAGGCACTCGGCGGGCACATGAACGTCCACCGCCTAGACCGGGCCCGCCTCCTCCTCCTCCCACCTTCTTCTTCTTCATCATCATCATCATCACCATC TCATCTCTCCCCACCGTCCGATCCGCTGCATGGCAGTACTGATGATGATGATGATTATGATGATAAGGAGCAGTACCATCGTCATCCTACCAACTTGCAG CTCACCACCTTCTTCCCTACTCATCGTGAGTCCGTACTGTTAATGGCGTCACATAAGTTAAAAGATGAAGAAGATCAGCAGGAGGAGCAAGCTGTTAGGT TGGATTTGGGAATGGAAGCAGCAGCAGCAGCTCCGAAACCAGCACTGGATTTGGAGCTCCGACTCGGCTGCTTCACCTCCGTGTAA
AA sequence Show only first row Show all	>Lus10024875 pacid=23178996 polypeptide=Lus10024875 locus=Lus10024875.g ID=Lus10024875.BGIv1.0 annot-version=v1.0 MEKTCRTRTKPRDPHPHHRSWYVCNFCRKDFSSAQALGGHMNVHRLDRARLLLLPPSSSSSSSSSPSHLSPPSDPLHGSTDDDDDYDDKEQYHRHPTNLQ LTTFFPTHRESVLLMASHKLKDEEDQQEEQAVRLDLGMEAAAAAPKPALDLELRLGCFTSV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G37740	C2H2ZnF	ATZFP10, ZFP10	zinc-finger protein 10 (.1)		Lus10024875 [exp]	0	1
AT1G48780			unknown protein		Lus10009633 [exp]	2.0	0.9306
AT1G47410			unknown protein		Lus10009767 [exp]	2.0	0.9472
AT2G30860		GLUTTR, ATGSTF7...	glutathione S-transferase PHI ...		Lus10001419 [exp]	2.8	0.9225
AT3G53620		ATPPA4	pyrophosphorylase 4 (.1)		Lus10024422 [exp]	4.2	0.9166
AT5G47635			Pollen Ole e 1 allergen and ex...		Lus10039078 [exp]	4.6	0.9241
AT5G10180		SULTR2;1, AST68	sulfate transporter 2;1, ARABI...		Lus10022502 [exp]	6.0	0.8971
AT3G53620		ATPPA4	pyrophosphorylase 4 (.1)		Lus10025311 [exp]	7.1	0.8894
AT4G23496		SP1L5	SPIRAL1-like5 (.1)		Lus10024667 [exp]	7.1	0.9221
AT4G12320		CYP706A6	"cytochrome P450, family 706, ...		Lus10024586 [exp]	8.4	0.9047
AT3G52740			unknown protein		Lus10021366 [exp]	8.9	0.8917

Compare expression of checked genes

Lus10024875 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.