Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G31200 230 / 2e-79 ADF6, ATADF6 actin depolymerizing factor 6 (.1) AT5G59890 189 / 4e-63 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2) AT3G46010 186 / 6e-62 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2) AT1G01750 184 / 2e-61 ADF11 actin depolymerizing factor 11 (.1) AT4G00680 183 / 1e-60 ADF8 actin depolymerizing factor 8 (.1) AT2G16700 181 / 5e-60 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2) AT4G34970 177 / 2e-58 ADF9 actin depolymerizing factor 9 (.1) AT5G59880 176 / 6e-58 ADF3 actin depolymerizing factor 3 (.1.2) AT4G25590 175 / 9e-58 ADF7 actin depolymerizing factor 7 (.1) AT3G46000 173 / 7e-57 ADF2 actin depolymerizing factor 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022933 [exp] 274 / 1e-96 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1) Lus10024418 [exp] 188 / 1e-62 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2) Lus10024417 [exp] 185 / 1e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025319 [exp] 185 / 1e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2) Lus10025049 [exp] 183 / 1e-60 AT2G16700 232 / 9e-80 actin depolymerizing factor 5 (.1.2) Lus10034494 [exp] 177 / 2e-58 AT4G34970 202 / 2e-68 actin depolymerizing factor 9 (.1) Lus10008489 [exp] 176 / 6e-58 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1) Lus10038859 [exp] 170 / 2e-55 AT4G25590 232 / 2e-80 actin depolymerizing factor 7 (.1) Lus10014977 [exp] 169 / 4e-55 AT4G25590 233 / 1e-80 actin depolymerizing factor 7 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G223800 [exp] 236 / 2e-81 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1) Potri.002G038800 [exp] 228 / 2e-78 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1) Potri.004G173800 [exp] 191 / 1e-63 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2) Potri.009G133100 [exp] 190 / 2e-63 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2) Potri.008G052100 [exp] 189 / 3e-63 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2) Potri.001G236700 [exp] 187 / 2e-62 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2) Potri.009G028200 [exp] 185 / 2e-61 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2) Potri.001G236400 [exp] 184 / 2e-61 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2) Potri.009G028100 [exp] 184 / 5e-61 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2) Potri.001G106200 [exp] 183 / 9e-61 AT4G00680 234 / 6e-81 actin depolymerizing factor 8 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0092 [flax] [poplar] ADF PF00241 [flax] [poplar] Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence Show only first row Show all	>Lus10024885 pacid=23178975 polypeptide=Lus10024885 locus=Lus10024885.g ID=Lus10024885.BGIv1.0 annot-version=v1.0 ATGGGAGTCGCCGAGCAGAGCCTCCAAACATTCACGGAGCTGCAGAGGAAGAAGGTCCACCGCTACGTAGTCTTCAAGATCGACGAGAAAAAGAAACAAG TCATCGTCGAGAAAACCGGCGCACCCGCCGAGAGCTACGAAGACTTCACCGCTTCCTTACCGGACAACGACTGCCGCTACGCCATCTACGACTACGACTT CGTCACCTCCGACAACTGCCAGAAGAGCAAGATCTTCTTCTTCGCCTGGTCACCATCGAGCTCCAGAATCAGGGCGAAGATGCTGTACGCGACGTCCAAG GATAGGTTCAGGAGGGAGCTTGACGGGATTCACTACGAGATCCAGGCTACTGATCCTACTGAACTGGATCTGGAGGTTCTTCAAGAACGTGCTAATTGA
AA sequence Show only first row Show all	>Lus10024885 pacid=23178975 polypeptide=Lus10024885 locus=Lus10024885.g ID=Lus10024885.BGIv1.0 annot-version=v1.0 MGVAEQSLQTFTELQRKKVHRYVVFKIDEKKKQVIVEKTGAPAESYEDFTASLPDNDCRYAIYDYDFVTSDNCQKSKIFFFAWSPSSSRIRAKMLYATSK DRFRRELDGIHYEIQATDPTELDLEVLQERAN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G31200		ADF6, ATADF6	actin depolymerizing factor 6 ...		Lus10024885 [exp]	0	1
AT4G29910		EMB2798, ORC5, ...	EMBRYO DEFECTIVE 2798, origin ...		Lus10036368 [exp]	1.0	0.8752
AT2G34690		ACD11	ACCELERATED CELL DEATH 11, Gly...		Lus10038537 [exp]	6.2	0.8172
AT5G14540			Protein of unknown function (D...		Lus10018089 [exp]	8.2	0.7548
AT2G45980		ATI1	ATG8-interacting protein 1, un...		Lus10014767 [exp]	15.2	0.7796
AT4G29850			Eukaryotic protein of unknown ...		Lus10019737 [exp]	18.2	0.7792
AT5G51280			DEAD-box protein abstrakt, put...		Lus10008856 [exp]	19.4	0.7213
AT3G50910			unknown protein		Lus10025996 [exp]	20.8	0.7410
AT1G51200			A20/AN1-like zinc finger famil...		Lus10031262 [exp]	21.7	0.7760
AT3G17000		UBC32	ubiquitin-conjugating enzyme 3...		Lus10016898 [exp]	22.9	0.7852
AT1G22040			Galactose oxidase/kelch repeat...		Lus10020960 [exp]	22.9	0.7902

Compare expression of checked genes

Lus10024885 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.