Lus10024897 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G31140 162 / 1e-51 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT1G06200 158 / 5e-50 Peptidase S24/S26A/S26B/S26C family protein (.1)
AT3G08980 40 / 6e-05 Peptidase S24/S26A/S26B/S26C family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022921 203 / 1e-67 AT2G31140 282 / 1e-97 Peptidase S24/S26A/S26B/S26C family protein (.1)
Lus10005571 39 / 0.0002 AT1G53530 213 / 1e-71 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
Lus10002492 38 / 0.0007 AT3G08980 191 / 5e-63 Peptidase S24/S26A/S26B/S26C family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.005G225100 167 / 2e-53 AT2G31140 274 / 2e-94 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.002G037900 164 / 1e-52 AT1G06200 264 / 2e-90 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.016G115100 40 / 6e-05 AT3G08980 204 / 3e-68 Peptidase S24/S26A/S26B/S26C family protein (.1)
Potri.007G071400 40 / 7e-05 AT1G53530 194 / 7e-64 Peptidase S24/S26A/S26B/S26C family protein (.1.2)
PFAM info
Representative CDS sequence
>Lus10024897 pacid=23178984 polypeptide=Lus10024897 locus=Lus10024897.g ID=Lus10024897.BGIv1.0 annot-version=v1.0
ATGATGTCATCGTTATTCCTCCACAGGCGAGTTTTTGTTGGAGACGTCGTGGTTTTAAAGGACCCTATTCAAGAAGACAAATACCTTGTAAGGCGATTGG
CTGCAGTTGAAGAGTATAAGATGGTCTCTAATGACGAAAAAGACGAGCCCTTTGTTCTTAACTGCTGGGTGGTTGCTGATAATGAGAAACTGAAAGCCAA
GGAAGCAAACGACAGTCGGAAATCCGGTCCAGTTCCAATGGCAAACATAGTCGGCCGGGCTATATACTGCCTGCGAACAGCGGTGGACCATGGCCCTGTC
CAGAACAGTGAGTTCAGCATGGGGAGGGATCTGCCGGTGTTGGAAGTGGAGCTGGATGTTGAAGAGATGGCTAAGAATCACAAAGCATAG
AA sequence
>Lus10024897 pacid=23178984 polypeptide=Lus10024897 locus=Lus10024897.g ID=Lus10024897.BGIv1.0 annot-version=v1.0
MMSSLFLHRRVFVGDVVVLKDPIQEDKYLVRRLAAVEEYKMVSNDEKDEPFVLNCWVVADNEKLKAKEANDSRKSGPVPMANIVGRAIYCLRTAVDHGPV
QNSEFSMGRDLPVLEVELDVEEMAKNHKA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G31140 Peptidase S24/S26A/S26B/S26C f... Lus10024897 0 1

Lus10024897 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.