Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G33340 174 / 5e-53 CDR1 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) AT1G64830 162 / 3e-48 Eukaryotic aspartyl protease family protein (.1) AT2G35615 140 / 4e-40 Eukaryotic aspartyl protease family protein (.1) AT1G31450 122 / 6e-33 Eukaryotic aspartyl protease family protein (.1) AT2G28010 105 / 5e-27 Eukaryotic aspartyl protease family protein (.1) AT2G28030 104 / 9e-27 Eukaryotic aspartyl protease family protein (.1) AT2G28040 97 / 6e-24 Eukaryotic aspartyl protease family protein (.1) AT2G28220 89 / 1e-20 Eukaryotic aspartyl protease family protein (.1) AT2G03200 85 / 2e-19 Eukaryotic aspartyl protease family protein (.1) AT1G01300 76 / 2e-16 Eukaryotic aspartyl protease family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024903 [exp] 325 / 2e-111 AT5G33340 449 / 3e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10024910 [exp] 321 / 5e-110 AT5G33340 452 / 2e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022912 [exp] 318 / 4e-109 AT5G33340 450 / 1e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10023445 [exp] 248 / 4e-81 AT5G33340 448 / 9e-156 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10041151 [exp] 245 / 3e-80 AT5G33340 445 / 1e-154 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10040325 [exp] 245 / 3e-80 AT5G33340 451 / 5e-157 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10022917 [exp] 231 / 2e-76 AT2G03200 194 / 2e-58 Eukaryotic aspartyl protease family protein (.1) Lus10002613 [exp] 228 / 1e-73 AT5G33340 406 / 4e-139 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Lus10018825 [exp] 216 / 7e-69 AT5G33340 432 / 1e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G114400 [exp] 184 / 1e-56 AT5G33340 475 / 1e-166 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G087900 [exp] 174 / 7e-53 AT5G33340 430 / 8e-149 CONSTITUTIVE DISEASE RESISTANCE 1, Eukaryotic aspartyl protease family protein (.1) Potri.003G105300 [exp] 142 / 9e-41 AT2G35615 414 / 2e-142 Eukaryotic aspartyl protease family protein (.1) Potri.001G306200 [exp] 90 / 3e-21 AT2G03200 501 / 1e-176 Eukaryotic aspartyl protease family protein (.1) Potri.019G002100 [exp] 85 / 1e-19 AT2G03200 529 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.002G171700 [exp] 79 / 2e-17 AT1G01300 642 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.014G099400 [exp] 73 / 2e-15 AT1G01300 633 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.015G113100 [exp] 67 / 3e-13 AT5G45120 588 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.012G118000 [exp] 63 / 6e-12 AT5G45120 575 / 0.0 Eukaryotic aspartyl protease family protein (.1) Potri.010G128200 [exp] 62 / 1e-11 AT1G25510 622 / 0.0 Eukaryotic aspartyl protease family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0129 [flax] [poplar] Peptidase_AA PF00026 [flax] [poplar] Asp Eukaryotic aspartyl protease
Representative CDS sequence Show only first row Show all	>Lus10024905 pacid=23178839 polypeptide=Lus10024905 locus=Lus10024905.g ID=Lus10024905.BGIv1.0 annot-version=v1.0 ATGCACTTTGGCAAAAATGCTATCGTTTCAGGAAACAATGTGGTGTCCACGCCACTCATCTCTAGTCCTTTGATGTCCACCTTTTACTTCCTTCAACTCC AAGCTGTTAGCGTTGGAAGCAAAAAGATACCCTTCCAAGGATCCTCTATTGGAAGTTCAGGTAATATCATAATCGACTCCGGAACCACGCTCACTCTCGT ACCTACAGATTTCTTGTCCCAGCTCTCTGATGCCGTGGAGAGCCAAGTCACCGGCGGTACGAAGACCAGCGATCCACAAGGATTGTTGAGCCTATGCTAC ATGGTGAACTCGAACCTCAAAGTGCCTCCGATCACAGCACATTTTCAGGGAGCAGACGTGGTGCTAACCTCGTACAATACTTTCATCGAAATGAGTGATA CGGTGACGTGTTTTGCTTTCTACGCTAACGACGAGTTAAGCATCTATGGAAACATCGCACAACAGAATTTCCTAATCGGCTACGACCTTCAGAAACAGAG TTTATCCTTCAAGCCAACAGATTGCACAAAGAACTGA
AA sequence Show only first row Show all	>Lus10024905 pacid=23178839 polypeptide=Lus10024905 locus=Lus10024905.g ID=Lus10024905.BGIv1.0 annot-version=v1.0 MHFGKNAIVSGNNVVSTPLISSPLMSTFYFLQLQAVSVGSKKIPFQGSSIGSSGNIIIDSGTTLTLVPTDFLSQLSDAVESQVTGGTKTSDPQGLLSLCY MVNSNLKVPPITAHFQGADVVLTSYNTFIEMSDTVTCFAFYANDELSIYGNIAQQNFLIGYDLQKQSLSFKPTDCTKN

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G33340		CDR1	CONSTITUTIVE DISEASE RESISTANC...		Lus10024905 [exp]	0	1
AT3G06520			agenet domain-containing prote...		Lus10037805 [exp]	4.7	0.7532
AT3G03450	GRAS	RGL2	RGA-like 2 (.1)		Lus10036457 [exp]	12.8	0.7521
AT5G26594		ARR24	response regulator 24 (.1)		Lus10004775 [exp]	15.7	0.7521
AT3G07040		RPS3, RPM1	RESISTANCE TO PSEUDOMONAS SYRI...		Lus10026765 [exp]	18.1	0.7521
AT3G12750		ZIP1	zinc transporter 1 precursor (...		Lus10019853 [exp]	20.2	0.7521
AT5G41040			HXXXD-type acyl-transferase fa...		Lus10039329 [exp]	22.2	0.7521
AT3G57530		ATCPK32, CDPK32...	calcium-dependent protein kina...		Lus10042370 [exp]	24.5	0.7410
AT4G13250		NYC1, NYC	NON-YELLOW COLORING 1, NAD(P)-...		Lus10034917 [exp]	25.6	0.7409
AT3G43860		ATGH9A4	glycosyl hydrolase 9A4 (.1)		Lus10009794 [exp]	35.4	0.7370
AT4G15610			Uncharacterised protein family...		Lus10033972 [exp]	38.2	0.7072

Compare expression of checked genes

Lus10024905 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.