Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G28530 199 / 4e-62 NAC ANAC074 NAC domain containing protein 74 (.1.2) AT1G56010 147 / 3e-43 NAC NAC1, ANAC021, ANAC022 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) AT1G76420 143 / 1e-40 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G24430 140 / 1e-39 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT3G12977 139 / 1e-39 NAC NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G07680 133 / 5e-37 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G61430 133 / 7e-37 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G39610 132 / 7e-37 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT3G15170 132 / 1e-36 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT5G62380 132 / 2e-36 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6, NAC-domain protein 101 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022915 [exp] 441 / 1e-157 AT4G28530 274 / 7e-91 NAC domain containing protein 74 (.1.2) Lus10033905 [exp] 234 / 3e-76 AT4G28530 271 / 2e-89 NAC domain containing protein 74 (.1.2) Lus10042466 [exp] 146 / 2e-41 AT1G56010 273 / 9e-90 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Lus10009029 [exp] 138 / 2e-38 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10028372 [exp] 138 / 2e-38 AT2G18060 349 / 4e-119 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10041822 [exp] 137 / 3e-38 AT2G18060 352 / 3e-120 Arabidopsis NAC domain containing protein 37, vascular related NAC-domain protein 1 (.1) Lus10009669 [exp] 137 / 3e-38 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10026879 [exp] 136 / 1e-37 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2) Lus10003435 [exp] 135 / 2e-37 AT5G18270 315 / 2e-106 Arabidopsis NAC domain containing protein 87 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G225800 [exp] 229 / 2e-74 AT4G28530 270 / 1e-89 NAC domain containing protein 74 (.1.2) Potri.002G037100 [exp] 215 / 3e-69 AT4G28530 276 / 6e-92 NAC domain containing protein 74 (.1.2) Potri.005G098200 [exp] 152 / 3e-44 AT1G56010 332 / 6e-114 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.007G065400 [exp] 145 / 1e-41 AT1G56010 337 / 4e-116 Arabidopsis NAC domain containing protein 22, Arabidopsis NAC domain containing protein 21, NAC domain containing protein 1 (.1.2) Potri.002G005800 [exp] 142 / 9e-40 AT1G76420 326 / 7e-110 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.005G255900 [exp] 140 / 3e-39 AT1G76420 295 / 4e-98 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G001400 [exp] 135 / 2e-37 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.006G277000 [exp] 135 / 2e-37 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.015G046800 [exp] 134 / 2e-37 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1) Potri.019G083600 [exp] 134 / 2e-37 AT1G71930 320 / 4e-109 Arabidopsis NAC domain containing protein 30, vascular related NAC-domain protein 7 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [flax] [poplar] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Lus10024908 pacid=23179006 polypeptide=Lus10024908 locus=Lus10024908.g ID=Lus10024908.BGIv1.0 annot-version=v1.0 ATGAACTTATATATATTGTTATTGTTTGGGGATGCAGAGGTGGCGAAGCTGAATGCGACAGAGTGGTACTTCTTCAGCTTCAGGGACCGGAAATACGCGA CCGGGTTCAGGACGAACAGGGCCACAATCTCCGGCTACTGGAAAGCGACGGGCAAAGATCGGACGGTGGTTGAACCGAACACCAAGGAGGTTGTAGGGAT GAGGAAAACACTGGTTTTCTACAGGAACAGAGCTCCCAACGGCATCAAAACCGGCTGGATCATGCACGAGTTTCGACTCGAAACCCCCCATCTCCCTCCC AAGGAAGACTGGGTGTTATGTAGAGTGTTCCACAAAAGCAAGGCATCATCAGACGACTACAACAATCTCAGCCCACCTATTTACTATAATTACAACCCTA CCCCTTTGGTCGAACCCAATAACCAATCCCCTCCAATCAACACCGGCCATCAGCTCGCCCTTCCGGCCACCGGAGGATATGATCATCACCACCAACAACA GCAGCAACATCCACCGGCGGCGGGGTCCTTGTTGACCCTTCTTCTTCAAGATAGAGAAAAGTTGTTGATGATGAACCATAAGGAGGATAGTAATCATGAT GACCATAAGAGTAGTAACCCTCAGAGTGAGATCATCGTCAGCTCGAAACCGAGTAGTAATATTGATCAAGTGGACCAGTTTGCTGGGTTCTTGTGGGATG AGATGAACTTGGACGAGACGTGCAGCTTGGGAGATGGTGTCGTCGTGGGCTCCGATTTCGATGACATGAGATTCGACCACATTGACACCAACAACATGGT TTTGCTATGA
AA sequence Show only first row Show all	>Lus10024908 pacid=23179006 polypeptide=Lus10024908 locus=Lus10024908.g ID=Lus10024908.BGIv1.0 annot-version=v1.0 MNLYILLLFGDAEVAKLNATEWYFFSFRDRKYATGFRTNRATISGYWKATGKDRTVVEPNTKEVVGMRKTLVFYRNRAPNGIKTGWIMHEFRLETPHLPP KEDWVLCRVFHKSKASSDDYNNLSPPIYYNYNPTPLVEPNNQSPPINTGHQLALPATGGYDHHHQQQQQHPPAAGSLLTLLLQDREKLLMMNHKEDSNHD DHKSSNPQSEIIVSSKPSSNIDQVDQFAGFLWDEMNLDETCSLGDGVVVGSDFDDMRFDHIDTNNMVLL

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G28530	NAC	ANAC074	NAC domain containing protein ...		Lus10024908 [exp]	0	1
AT3G22040			Domain of unknown function (DU...		Lus10007504 [exp]	1.7	0.7894
AT5G05490		SYN1 BP5, SYN1 ...	SYNAPTIC 1, DETERMINATE, INFER...		Lus10022711 [exp]	1.7	0.8117
AT3G59350			Protein kinase superfamily pro...		Lus10025496 [exp]	4.2	0.7977
AT1G07540	MYB	TRFL2	TRF-like 2 (.1)		Lus10040795 [exp]	11.0	0.7790
AT4G40010		SNRK2-7, SNRK2....	SUCROSE NONFERMENTING 1-RELATE...		Lus10015676 [exp]	12.1	0.7303
AT5G32450			RNA binding (RRM/RBD/RNP motif...		Lus10013651 [exp]	13.0	0.7228
AT5G53310			myosin heavy chain-related (.1...		Lus10039322 [exp]	13.3	0.7300
AT2G25290		Phox1	Phox1, Octicosapeptide/Phox/Be...		Lus10001927 [exp]	15.0	0.7467
AT4G35310		CPK5, ATCPK5	calmodulin-domain protein kina...		Lus10022986 [exp]	16.2	0.7298
AT5G50000			Protein kinase superfamily pro...		Lus10002368 [exp]	18.5	0.6971

Compare expression of checked genes

Lus10024908 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.