Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20490 107 / 9e-33 NOP10, EDA27 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022910 [exp] 134 / 8e-43 AT2G20490 107 / 5e-32 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2) Lus10033907 [exp] 132 / 1e-42 AT2G20490 107 / 9e-33 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.005G226300 [exp] 117 / 1e-36 AT2G20490 115 / 6e-36 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2) Potri.002G036500 [exp] 116 / 2e-36 AT2G20490 116 / 3e-36 EMBRYO SAC DEVELOPMENT ARREST 27, nucleolar RNA-binding Nop10p family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04135 [flax] [poplar] Nop10p Nucleolar RNA-binding protein, Nop10p family
Representative CDS sequence Show only first row Show all	>Lus10024913 pacid=23178904 polypeptide=Lus10024913 locus=Lus10024913.g ID=Lus10024913.BGIv1.0 annot-version=v1.0 ATGTTGCTGCAGTACTACATCAACGACAACGGCGACAAAGTCTACACCACCAAGAAGGAATCGCCAGTTGGTTTGGCTACGCAGTCTGCTCATCCTGCTC GCTTCTCTCCCGATGACAAATACGCTAGGCAAAGGTATCTGTTGAAGAAGCGATTCGGGTTGCTGCCTACTCAACAACCTCCCCAGAAGTACTGA
AA sequence Show only first row Show all	>Lus10024913 pacid=23178904 polypeptide=Lus10024913 locus=Lus10024913.g ID=Lus10024913.BGIv1.0 annot-version=v1.0 MLLQYYINDNGDKVYTTKKESPVGLATQSAHPARFSPDDKYARQRYLLKKRFGLLPTQQPPQKY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20490		NOP10, EDA27	EMBRYO SAC DEVELOPMENT ARREST ...		Lus10024913 [exp]	0	1
AT1G26740			Ribosomal L32p protein family ...		Lus10008442 [exp]	3.5	0.8580
AT5G66540			unknown protein		Lus10042107 [exp]	6.3	0.7496
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Lus10036911 [exp]	6.5	0.8417
AT2G21580			Ribosomal protein S25 family p...		Lus10034277 [exp]	7.1	0.8409
AT5G67500		VDAC2, ATVDAC2	ARABIDOPSIS THALIANA VOLTAGE D...		Lus10018683 [exp]	8.8	0.8116
AT1G05730			Eukaryotic protein of unknown ...		Lus10025588 [exp]	11.2	0.7798
AT4G18905			Transducin/WD40 repeat-like su...		Lus10001126 [exp]	12.5	0.7498
AT1G74270			Ribosomal protein L35Ae family...		Lus10035539 [exp]	13.3	0.7866
AT1G09590			Translation protein SH3-like f...		Lus10021079 [exp]	13.6	0.8209
AT3G05070			unknown protein		Lus10042290 [exp]	15.3	0.7959

Compare expression of checked genes

Lus10024913 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.