Lus10024918 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20450 224 / 4e-77 Ribosomal protein L14 (.1)
AT4G27090 223 / 1e-76 Ribosomal protein L14 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10011807 254 / 8e-89 AT2G20450 221 / 9e-76 Ribosomal protein L14 (.1)
Lus10008246 254 / 9e-89 AT2G20450 228 / 8e-79 Ribosomal protein L14 (.1)
Lus10021170 251 / 8e-88 AT2G20450 218 / 1e-74 Ribosomal protein L14 (.1)
Lus10003627 153 / 2e-49 AT4G27090 139 / 2e-44 Ribosomal protein L14 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G168600 240 / 3e-83 AT4G27090 230 / 2e-79 Ribosomal protein L14 (.1)
Potri.010G069900 237 / 2e-82 AT4G27090 228 / 2e-78 Ribosomal protein L14 (.1)
Potri.005G227300 236 / 1e-81 AT4G27090 235 / 3e-81 Ribosomal protein L14 (.1)
Potri.002G035700 235 / 3e-81 AT4G27090 234 / 8e-81 Ribosomal protein L14 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0107 KOW PF01929 Ribosomal_L14e Ribosomal protein L14
Representative CDS sequence
>Lus10024918 pacid=23178973 polypeptide=Lus10024918 locus=Lus10024918.g ID=Lus10024918.BGIv1.0 annot-version=v1.0
ATGGGTTTCAAGAGGTACGTGGAGATCGGAAGAGTGGCCCTCATCAACTACGGGAAGGAGTACGGAAAGCTCGTCGTGATCGTCGATGTCGTCGATCAGA
ACAGGGCTTTGGTCGATTCACCAGATATGGTGAGAAGCCAGATCAACTTCAAGAGGTTGACACTCACAGATATCAAGATTGAGATCAATAGGGTTCCCAA
GAAGAAGACGCTAGTTGAAGCTATGGAGAAAGCAGATGTGAAGGGCAAATGGGAGAACAGTTCATGGGGAAGGAAGCTCATTGTTCAGAAGAGAAGAGCT
GCTCTCACCGATTTCGACAGGTTCAAGGTCATGTTGGCGAAGATTAAGAGGGGAGGACTCATCAAGCAGGAGCTTGCGAAACTTAAAAAGGAGTCTGCTT
AG
AA sequence
>Lus10024918 pacid=23178973 polypeptide=Lus10024918 locus=Lus10024918.g ID=Lus10024918.BGIv1.0 annot-version=v1.0
MGFKRYVEIGRVALINYGKEYGKLVVIVDVVDQNRALVDSPDMVRSQINFKRLTLTDIKIEINRVPKKKTLVEAMEKADVKGKWENSSWGRKLIVQKRRA
ALTDFDRFKVMLAKIKRGGLIKQELAKLKKESA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20450 Ribosomal protein L14 (.1) Lus10024918 0 1
AT2G19740 Ribosomal protein L31e family ... Lus10042028 1.4 0.9428
AT3G23390 Zinc-binding ribosomal protein... Lus10013436 3.5 0.9066
AT5G02960 Ribosomal protein S12/S23 fami... Lus10023172 3.9 0.8902
AT1G26880 Ribosomal protein L34e superfa... Lus10036750 3.9 0.9060
AT2G18400 ribosomal protein L6 family pr... Lus10026015 5.5 0.8845
AT3G52570 alpha/beta-Hydrolases superfam... Lus10021315 6.0 0.8915
AT5G65860 ankyrin repeat family protein ... Lus10032850 6.7 0.8668
AT2G03870 EMB2816 EMBRYO DEFECTIVE 2816, Small n... Lus10035639 7.1 0.8354
AT2G44620 MTACP1, MTACP-1 mitochondrial acyl carrier pro... Lus10043348 7.3 0.8353
AT1G70350 unknown protein Lus10013008 7.5 0.8836

Lus10024918 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.