Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G20420 176 / 3e-55 ATP citrate lyase (ACL) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022902 [exp] 182 / 3e-61 AT2G20420 196 / 8e-63 ATP citrate lyase (ACL) family protein (.1) Lus10008238 [exp] 183 / 9e-58 AT2G20420 766 / 0.0 ATP citrate lyase (ACL) family protein (.1) Lus10003620 [exp] 183 / 1e-57 AT2G20420 763 / 0.0 ATP citrate lyase (ACL) family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G259600 [exp] 180 / 1e-56 AT2G20420 741 / 0.0 ATP citrate lyase (ACL) family protein (.1) Potri.014G195700 [exp] 176 / 5e-55 AT2G20420 745 / 0.0 ATP citrate lyase (ACL) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0506 [flax] [poplar] Succ_CoA_synth PF00549 [flax] [poplar] Ligase_CoA CoA-ligase
Representative CDS sequence Show only first row Show all	>Lus10024923 pacid=23178826 polypeptide=Lus10024923 locus=Lus10024923.g ID=Lus10024923.BGIv1.0 annot-version=v1.0 ATGACACAGATCAATCCCATTGCAGAAACTTCTGATAACAAATTGGTAGCAGCTGATGCTAAGATGAACTTTGATGATAATGCTGCTCTCCGTCAAAAGG AGTTATTTGCTCTTCGTGATCCTACGCAAGAGGATCCTCGAGAGGTGGCAGCTGCAAAGGCAGATTTGAATTATATCCATGGCGAGATTGGTTGCATGGT GAATGGCGCAGGGTTGGCAATGGCCACGATGGATATTATTAAACGGCATGGCGGAACTCCTGCCAATTTCCTCGATGTCGGTGGAAATGCTCCGAAGGAC AGGTAA
AA sequence Show only first row Show all	>Lus10024923 pacid=23178826 polypeptide=Lus10024923 locus=Lus10024923.g ID=Lus10024923.BGIv1.0 annot-version=v1.0 MTQINPIAETSDNKLVAADAKMNFDDNAALRQKELFALRDPTQEDPREVAAAKADLNYIHGEIGCMVNGAGLAMATMDIIKRHGGTPANFLDVGGNAPKD R

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G20420			ATP citrate lyase (ACL) family...		Lus10024923 [exp]	0	1
					Lus10011061 [exp]	1.7	1.0000
					Lus10009800 [exp]	3.2	1.0000
AT3G07740		HXA2, HXA02, HA...	homolog of yeast ADA2 2A (.1.2...		Lus10012337 [exp]	4.6	1.0000
					Lus10011848 [exp]	5.5	1.0000
					Lus10011496 [exp]	5.7	1.0000
AT5G46795		MSP2	microspore-specific promoter ...		Lus10004566 [exp]	6.0	1.0000
AT3G25050		XTH3	xyloglucan endotransglucosylas...		Lus10011845 [exp]	6.3	1.0000
AT1G12570			Glucose-methanol-choline (GMC)...		Lus10002957 [exp]	6.7	1.0000
AT4G10020		ATHSD5	hydroxysteroid dehydrogenase 5...		Lus10001280 [exp]	6.9	1.0000
AT3G20760			Nse4, component of Smc5/6 DNA ...		Lus10004185 [exp]	7.1	1.0000

Compare expression of checked genes

Lus10024923 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.