Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	No hit found
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022884 [exp] 99 / 2e-29 ND /
Poplar homologues Show only best Show top 10	No hit found
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024939 pacid=23178922 polypeptide=Lus10024939 locus=Lus10024939.g ID=Lus10024939.BGIv1.0 annot-version=v1.0 ATGAAGATAACAGTGCGTGGCCATTTGTTCTCTGTTGCCAATGAATACTTGAGTGGAATTACGGTGGTTTGCATGGTGGTGGTGATGTGGTTGTGTACGG GATCTTCTTACTGCTTGTTACTTGCTAGTAGCCAGAATTGTTCTCTGGTTTCAGTGGATTATTGA
AA sequence Show only first row Show all	>Lus10024939 pacid=23178922 polypeptide=Lus10024939 locus=Lus10024939.g ID=Lus10024939.BGIv1.0 annot-version=v1.0 MKITVRGHLFSVANEYLSGITVVCMVVVMWLCTGSSYCLLLASSQNCSLVSVDY

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
					Lus10024939 [exp]	0	1
					Lus10000348 [exp]	3.3	0.8395
AT3G63380			ATPase E1-E2 type family prote...		Lus10004087 [exp]	4.2	0.8297
AT1G30370		DLAH	DAD1-like acylhydrolase, alpha...		Lus10023281 [exp]	6.5	0.8388
ATCG01280		ATCG01280.1, YC...	Chloroplast Ycf2;ATPase, AAA t...		Lus10007142 [exp]	6.7	0.8146
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10001686 [exp]	8.0	0.8234
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Lus10003299 [exp]	10.4	0.8010
ATCG00680		ATCG00680.1, PS...	photosystem II reaction center...		Lus10006593 [exp]	11.2	0.8130
AT5G42905			Polynucleotidyl transferase, r...		Lus10005922 [exp]	11.8	0.7810
AT1G27180			disease resistance protein (TI...		Lus10040576 [exp]	12.6	0.7950
AT1G03090		MCCA	methylcrotonyl-CoA carboxylase...		Lus10022078 [exp]	14.2	0.8106

Compare expression of checked genes

Lus10024939 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.