Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G04400 215 / 1e-73 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) AT2G33370 215 / 1e-73 Ribosomal protein L14p/L23e family protein (.1) AT1G04480 215 / 1e-73 Ribosomal protein L14p/L23e family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022882 [exp] 225 / 4e-78 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10020499 [exp] 216 / 4e-74 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1) Lus10012464 [exp] 216 / 4e-74 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Lus10042695 [exp] 216 / 4e-74 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1) Lus10023730 [exp] 216 / 4e-74 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1) Lus10011773 [exp] 217 / 1e-73 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10022881 [exp] 215 / 3e-73 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10024943 [exp] 214 / 5e-73 AT1G04480 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1) Lus10008065 [exp] 92 / 8e-26 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G171200 [exp] 216 / 3e-74 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G066400 [exp] 216 / 3e-74 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.002G257500 [exp] 216 / 3e-74 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.011G127250 [exp] 159 / 5e-52 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.004G166200 [exp] 125 / 9e-39 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.010G167700 [exp] 125 / 1e-38 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2) Potri.003G136400 [exp] 121 / 4e-37 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00238 [flax] [poplar] Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence Show only first row Show all	>Lus10024942 pacid=23178933 polypeptide=Lus10024942 locus=Lus10024942.g ID=Lus10024942.BGIv1.0 annot-version=v1.0 ATGTCCCTTGGACTTCCGGTGGCGGCGACGGTCAACTGCGCCGATAACACTGGAGCAAAGAACTTGTACATCATCTCCGTGAAAGGAATCAAAGGTAGAC TCAACAGGCTGCCGTCTGCTTGCGTCGGGGACATGGTGATGGCCACGGTGAAGAAGGGGAAGCCTGATCTCAGGAAGAAGGTGATGCCTGCTGTCATCGT CAGGCAGCGCAAGCCATGGCGCCGAAAGGATGGTGTGTTTATGTACTTCGAAGGATCTGCTATCACTGGCCCCATCGGAAAGGAGTGCGCTGATCTGTGG CCAAGGATTGCGAGTGCAGCGAATGCCATCGTCTGA
AA sequence Show only first row Show all	>Lus10024942 pacid=23178933 polypeptide=Lus10024942 locus=Lus10024942.g ID=Lus10024942.BGIv1.0 annot-version=v1.0 MSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKGKPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEGSAITGPIGKECADLW PRIASAANAIV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10024942 [exp]	0	1
AT3G04400		EMB2171	embryo defective 2171, Ribosom...		Lus10012464 [exp]	1.4	0.8697
AT4G24830			arginosuccinate synthase famil...		Lus10033978 [exp]	1.4	0.8490
AT2G33370			Ribosomal protein L14p/L23e fa...		Lus10042695 [exp]	2.8	0.8205
AT5G22650		ATHD2B, HDT2, H...	ARABIDOPSIS HISTONE DEACETYLAS...		Lus10020543 [exp]	4.0	0.7843
AT2G32060			Ribosomal protein L7Ae/L30e/S1...		Lus10023825 [exp]	7.1	0.8225
AT4G18100			Ribosomal protein L32e (.1)		Lus10004589 [exp]	11.6	0.8165
AT2G25830			YebC-related (.1)		Lus10038722 [exp]	12.0	0.7294
AT2G15910			CSL zinc finger domain-contain...		Lus10021009 [exp]	12.2	0.7388
AT4G15000			Ribosomal L27e protein family ...		Lus10010461 [exp]	14.5	0.7997
AT5G62300			Ribosomal protein S10p/S20e fa...		Lus10027194 [exp]	16.4	0.7842

Compare expression of checked genes

Lus10024942 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.