Lus10024943 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G04400 270 / 1e-94 EMB2171 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
AT2G33370 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
ATCG00780 67 / 7e-15 ATCG00780.1, RPL14 ribosomal protein L14 (.1)
AT1G17560 45 / 7e-06 HLL HUELLENLOS, Ribosomal protein L14p/L23e family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042695 275 / 5e-96 AT2G33370 273 / 8e-96 Ribosomal protein L14p/L23e family protein (.1)
Lus10023730 273 / 1e-95 AT2G33370 278 / 3e-98 Ribosomal protein L14p/L23e family protein (.1)
Lus10022881 272 / 1e-94 AT1G04480 270 / 1e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10011773 272 / 1e-94 AT2G33370 270 / 2e-94 Ribosomal protein L14p/L23e family protein (.1)
Lus10020499 251 / 3e-87 AT1G04480 251 / 6e-88 Ribosomal protein L14p/L23e family protein (.1)
Lus10012464 251 / 3e-87 AT3G04400 251 / 6e-88 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10024942 214 / 7e-73 AT2G33370 214 / 1e-73 Ribosomal protein L14p/L23e family protein (.1)
Lus10022882 214 / 7e-73 AT3G04400 214 / 1e-73 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Lus10008065 91 / 1e-24 AT1G04480 91 / 6e-26 Ribosomal protein L14p/L23e family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.008G171200 273 / 9e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G066400 273 / 9e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.002G257500 273 / 9e-96 AT3G04400 278 / 3e-98 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.011G127250 189 / 1e-62 AT3G04400 189 / 2e-63 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G167700 161 / 5e-52 AT3G04400 160 / 9e-53 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.003G136400 158 / 1e-50 AT3G04400 157 / 2e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.004G166200 156 / 3e-50 AT3G04400 156 / 5e-51 embryo defective 2171, Ribosomal protein L14p/L23e family protein (.1.2)
Potri.010G022800 44 / 1e-05 AT5G46160 199 / 3e-66 Ribosomal protein L14p/L23e family protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00238 Ribosomal_L14 Ribosomal protein L14p/L23e
Representative CDS sequence
>Lus10024943 pacid=23178842 polypeptide=Lus10024943 locus=Lus10024943.g ID=Lus10024943.BGIv1.0 annot-version=v1.0
ATGGGAAACCCTTTGACCACCTCTCTTCGAGTGGGCCGAATATGGGTCCATCATGAAGAAGCAGGGCTTGTGGGCTTTTGGCCATGTTGCTACAGCGCAA
TGGACGGAGGTAGAGGAGGAAGTGCGGGGAACAAGTTCAGGATGTCCCTTGGACTTCCGGTGGCGGCGACGGTGAACTGCGCCGACAACACCGGGGCAAA
GAACTTGTACATCATCTCAGTGAAAGGGATCAAAGGTAGACTCAACAGGCTGCCTTCTGCTTGCGTCGGGGACATGGTGATGGCCACCGTGAAGAAGGGT
AAGCCTGATCTGAGGAAGAAGGTTATGCCTGCTGTCATCGTCAGGCAGCGCAAGCCATGGCGCCGAAAGGACGGTGTCTTCATGTATTTCGAAGATAATG
CTGGTGTGATTGTGAACCCCAAAGGAGAAATGAAGGGATCTGCTATCACCGGCCCCATCGGAAAGGAGTGTGCTGATCTGTGGCCAAGAATCGCTAGTGC
AGCAAATGCGATTGTCTGA
AA sequence
>Lus10024943 pacid=23178842 polypeptide=Lus10024943 locus=Lus10024943.g ID=Lus10024943.BGIv1.0 annot-version=v1.0
MGNPLTTSLRVGRIWVHHEEAGLVGFWPCCYSAMDGGRGGSAGNKFRMSLGLPVAATVNCADNTGAKNLYIISVKGIKGRLNRLPSACVGDMVMATVKKG
KPDLRKKVMPAVIVRQRKPWRRKDGVFMYFEDNAGVIVNPKGEMKGSAITGPIGKECADLWPRIASAANAIV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT1G04480 Ribosomal protein L14p/L23e fa... Lus10024943 0 1
AT5G52470 ATFIB1, ATFBR1,... SKP1/ASK1-INTERACTING PROTEIN,... Lus10014969 1.7 0.8737
AT1G43170 RPL3A, ARP1, EM... embryo defective 2207, ribosom... Lus10006181 2.4 0.8688
AT5G62300 Ribosomal protein S10p/S20e fa... Lus10031705 2.6 0.8324
AT1G50270 Pentatricopeptide repeat (PPR)... Lus10023251 3.0 0.8247
AT3G02080 Ribosomal protein S19e family ... Lus10030702 4.0 0.8735
AT1G05730 Eukaryotic protein of unknown ... Lus10027051 6.2 0.8188
AT3G55605 Mitochondrial glycoprotein fam... Lus10030157 7.4 0.8443
AT2G33370 Ribosomal protein L14p/L23e fa... Lus10042695 8.3 0.7920
AT5G52470 ATFIB1, ATFBR1,... SKP1/ASK1-INTERACTING PROTEIN,... Lus10038851 8.5 0.8189
AT1G70600 Ribosomal protein L18e/L15 sup... Lus10039528 9.4 0.7946

Lus10024943 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.