Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G43960 150 / 1e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G25150 83 / 2e-18 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT5G60980 78 / 1e-16 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT3G07250 67 / 1e-12 nuclear transport factor 2 (NTF2) family protein / RNA recognition motif (RRM)-containing protein (.1) AT5G48650 65 / 4e-12 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) AT2G03640 56 / 3e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain AT1G69250 55 / 6e-09 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) AT1G03457 46 / 7e-06 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT3G49430 44 / 5e-05 SRP34A, SR34a, At-SR34a Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) AT5G19960 42 / 0.0001 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10022873 [exp] 313 / 5e-106 AT5G43960 377 / 1e-127 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10014469 [exp] 110 / 2e-28 AT5G43960 156 / 4e-43 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10023722 [exp] 107 / 9e-27 AT5G43960 266 / 2e-83 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10022765 [exp] 81 / 1e-17 AT3G25150 408 / 1e-138 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10003144 [exp] 81 / 2e-17 AT3G25150 385 / 2e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10025906 [exp] 70 / 1e-13 AT3G25150 363 / 4e-118 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Lus10043008 [exp] 44 / 3e-05 AT5G65260 278 / 4e-96 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10015564 [exp] 42 / 0.0001 AT3G49430 324 / 6e-112 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3) Lus10032940 [exp] 42 / 0.0001 AT3G49430 328 / 7e-113 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G257000 [exp] 189 / 8e-58 AT5G43960 402 / 3e-137 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.014G192900 [exp] 182 / 5e-55 AT5G43960 392 / 3e-133 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.010G065500 [exp] 136 / 9e-38 AT5G43960 310 / 3e-101 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.015G058700 [exp] 77 / 3e-16 AT5G60980 382 / 9e-129 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.017G094600 [exp] 73 / 6e-15 AT5G60980 286 / 6e-92 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.002G246600 [exp] 72 / 1e-14 AT3G25150 374 / 8e-125 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1), Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.2) Potri.008G096700 [exp] 62 / 2e-11 AT2G03640 219 / 3e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain Potri.010G157800 [exp] 62 / 4e-11 AT1G13730 219 / 4e-66 Nuclear transport factor 2 (NTF2) family protein with RNA binding (RRM-RBD-RNP motifs) domain (.1) Potri.007G095800 [exp] 44 / 3e-05 AT5G10350 285 / 3e-98 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.015G004600 [exp] 44 / 4e-05 AT3G49430 303 / 1e-103 Serine/Arginine-Rich Protein Splicing Factor 34a, SER/ARG-rich protein 34A (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [flax] [poplar] RRM PF00076 [flax] [poplar] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Lus10024953 pacid=23178939 polypeptide=Lus10024953 locus=Lus10024953.g ID=Lus10024953.BGIv1.0 annot-version=v1.0 ATGGCCGCTCCGTATCCGGGACCCGTGTCTGCCATTCAGTTGAAAGTTGCTAAGGGGCCACAGGCACCAGCTGTTGCACAGCCACCTGTGATCAAAAGTG TGCCAGCTTCTTCAGAGTGGAACCATGTATCAGTGCCTGTTGCTCAGCAGTCGGATGCAGGGTTGTCAGTTCTGCCCGAGCCTGCAAATGACGTAACAGA AGACGGGTTTGAAGATGACGGTGAATTCAAATCTGTCTATGTTCGCAACTTGCCATCCGATATTACAGCTGCCGAAATCGAACAGGAGTTCAGAAACTTC GGTAGAATAAGCCCCGACGGTGTCTTCGTCAGGAACCGAAAAGATGTCATTGGTGTATGTTACGCATTCGTTGAATTTGAAGACCTTGTGAGTGTTCAGA ACGCAATAAAGTCATCTCCTATTCAATTAGCGGGGAGACAAGTGTACATTGAAGAACGAAGACCAACCGGAGGCATTGCTTCCCGAGGTGGAAGAGGAGG AAGGGGAAGAGGCCGAGGTGGTTACCCCATGGAAGCCCCACGCGGCCGCTACAGTGGTGGCCGCGGTTTAGGCAGATCGAGCAACCAAGACAATGGCGAA TACAATAATCGATCGAGGGGCAATGGTTACCCTCAGCGCTCTACGCGATAG
AA sequence Show only first row Show all	>Lus10024953 pacid=23178939 polypeptide=Lus10024953 locus=Lus10024953.g ID=Lus10024953.BGIv1.0 annot-version=v1.0 MAAPYPGPVSAIQLKVAKGPQAPAVAQPPVIKSVPASSEWNHVSVPVAQQSDAGLSVLPEPANDVTEDGFEDDGEFKSVYVRNLPSDITAAEIEQEFRNF GRISPDGVFVRNRKDVIGVCYAFVEFEDLVSVQNAIKSSPIQLAGRQVYIEERRPTGGIASRGGRGGRGRGRGGYPMEAPRGRYSGGRGLGRSSNQDNGE YNNRSRGNGYPQRSTR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT5G43960			Nuclear transport factor 2 (NT...		Lus10024953 [exp]	0	1
AT3G57490			Ribosomal protein S5 family pr...		Lus10027358 [exp]	4.4	0.9622
AT5G10360		RPS6B, EMB3010	Ribosomal protein small subuni...		Lus10035414 [exp]	7.2	0.9496
AT4G35630		PSAT	phosphoserine aminotransferase...		Lus10005333 [exp]	9.4	0.9310
AT1G61870		PPR336	pentatricopeptide repeat 336 (...		Lus10020055 [exp]	9.9	0.9445
AT1G23290		RPL27A, RPL27AB	RIBOSOMAL PROTEIN L27A, Riboso...		Lus10004617 [exp]	11.0	0.9371
AT2G01720			Ribophorin I (.1)		Lus10040410 [exp]	12.4	0.9395
AT3G11400		ATEIF3G1, EIF3G...	eukaryotic translation initiat...		Lus10030482 [exp]	13.4	0.9307
AT2G46900			unknown protein		Lus10010275 [exp]	14.0	0.9230
AT5G42790		ARS5, ATPSM30, ...	ARSENIC TOLERANCE 5, proteasom...		Lus10007396 [exp]	14.9	0.9285
AT3G09630			Ribosomal protein L4/L1 family...		Lus10026476 [exp]	15.0	0.9418

Compare expression of checked genes

Lus10024953 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.