Lus10024957 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20390 127 / 5e-38 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022869 249 / 3e-86 AT2G20390 196 / 2e-64 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G256700 168 / 4e-54 AT2G20390 195 / 8e-64 unknown protein
PFAM info
Representative CDS sequence
>Lus10024957 pacid=23178899 polypeptide=Lus10024957 locus=Lus10024957.g ID=Lus10024957.BGIv1.0 annot-version=v1.0
ATGGAGAGAGCACGTAAGAACGAGGCAGTTAAAGAAGCTATCGGCGAACCAGTAACAAAAGGTGCATGGTACAACGCTTCGCTTGCAGTAGCTCACAAAA
GGCAATCTGTTTCTTGTTCGTTTCCGGTCTCTGGACCACGTGGCGATGGAGTTGTACGGCTGAAAGCAGTTCGTAATCCAGATGACAACTGGTTGTCGTA
TATCCTCCCTCGGGACTGGGAGATTGTGATTATGGATGCTCTCCTCCACATTCCGGGCAACGAAGGATCTGGCTCCTTAACGCAGCGGATCAGCCTATTG
GACAGCTCTCCGCAAGCATGCCAGCCTTGCATGACTTGCCCAAGACCCCAAGAAACCCAGAAGACAGAAAGCAAATGA
AA sequence
>Lus10024957 pacid=23178899 polypeptide=Lus10024957 locus=Lus10024957.g ID=Lus10024957.BGIv1.0 annot-version=v1.0
MERARKNEAVKEAIGEPVTKGAWYNASLAVAHKRQSVSCSFPVSGPRGDGVVRLKAVRNPDDNWLSYILPRDWEIVIMDALLHIPGNEGSGSLTQRISLL
DSSPQACQPCMTCPRPQETQKTESK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20390 unknown protein Lus10024957 0 1
AT1G80480 PTAC17 plastid transcriptionally acti... Lus10018172 11.6 0.7858
AT1G34160 Tetratricopeptide repeat (TPR)... Lus10004197 15.2 0.7474
AT5G47460 Pentatricopeptide repeat (PPR)... Lus10028953 19.4 0.7418
AT5G66520 Tetratricopeptide repeat (TPR)... Lus10038396 20.0 0.7579
AT3G23710 AtTic22-III translocon at the inner envelo... Lus10022378 22.6 0.7328
AT1G73240 unknown protein Lus10026209 24.3 0.7723
AT3G02010 Pentatricopeptide repeat (PPR)... Lus10035164 25.2 0.7670
AT4G27460 Cystathionine beta-synthase (C... Lus10025651 25.7 0.6774
AT4G24830 arginosuccinate synthase famil... Lus10030725 29.2 0.7586
AT3G15130 Tetratricopeptide repeat (TPR)... Lus10024376 34.1 0.7225

Lus10024957 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.