Lus10024963 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G20362 50 / 1e-08 unknown protein
AT1G63310 40 / 0.0002 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10022860 182 / 2e-58 AT2G20362 49 / 2e-07 unknown protein
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G256100 54 / 3e-10 AT2G20362 62 / 3e-13 unknown protein
Potri.002G034700 40 / 0.0003 AT1G75260 183 / 4e-51 oxidoreductases, acting on NADH or NADPH (.1)
PFAM info
Representative CDS sequence
>Lus10024963 pacid=23178960 polypeptide=Lus10024963 locus=Lus10024963.g ID=Lus10024963.BGIv1.0 annot-version=v1.0
ATGGGAGCAGAAACTTACGAAGATGACTACTTCCATGAATTGAACCTTGAAGGAAAGAATGATGGTGCAACAATGTACATTCAGTCTGGTTCCTCATCCG
CAGAGCTTCAACCAGGTGTCTGCATCAACATCTACGTGAACAACAATGTTCAAGGGGTGAACAACTCCATGGTGATGCAAAGTGACGTCAAGATGACGAA
TCCCGGCGTTGCCATCTACCTAGATGGCCTCAAGCTTGGCAAAAGAGTGAAACAGAAGAAGGCACCATGTCGACTGTCAAAGAGGAAATGCAGTAAATCG
GGAGAAGTGATGATCTCAAGATCAGATTCTAAATTAGGGGAAGAAGTAGAGGTTTCGAGATCAGATTCTCAGTTAGGGTTTGCTGCACTCCCTAGGTTGC
TTCTTTTCTCTGTGGTTTTCTTCCCAGCTTTTGTGTTCATGTCATTCATATAA
AA sequence
>Lus10024963 pacid=23178960 polypeptide=Lus10024963 locus=Lus10024963.g ID=Lus10024963.BGIv1.0 annot-version=v1.0
MGAETYEDDYFHELNLEGKNDGATMYIQSGSSSAELQPGVCINIYVNNNVQGVNNSMVMQSDVKMTNPGVAIYLDGLKLGKRVKQKKAPCRLSKRKCSKS
GEVMISRSDSKLGEEVEVSRSDSQLGFAALPRLLLFSVVFFPAFVFMSFI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G20362 unknown protein Lus10024963 0 1
AT1G76770 HSP20-like chaperones superfam... Lus10028577 1.0 0.9769
AT1G54400 HSP20-like chaperones superfam... Lus10013655 1.4 0.9661
Lus10035158 3.0 0.9471
Lus10037173 4.6 0.9585
AT1G47271 Cystathionine beta-synthase (C... Lus10001964 6.0 0.9526
AT1G27180 disease resistance protein (TI... Lus10007831 6.3 0.9543
AT1G35470 SPla/RYanodine receptor (SPRY)... Lus10020191 7.1 0.9460
AT1G76770 HSP20-like chaperones superfam... Lus10018882 7.4 0.9459
AT3G01680 SEOR1, SEOb Sieve-Element-Occlusion-Relate... Lus10000547 8.4 0.8707
Lus10035810 8.5 0.9124

Lus10024963 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.