Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G37340 156 / 6e-45 CYP81D3 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) AT4G37370 153 / 6e-44 CYP81D8 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) AT3G28740 147 / 1e-41 CYP81D11, CYP81D1 cytochrome P450, family 81, subfamily D, polypeptide 11, Cytochrome P450 superfamily protein (.1) AT2G23190 146 / 6e-41 CYP81D7 "cytochrome P450, family 81, subfamily D, polypeptide 7", cytochrome P450, family 81, subfamily D, polypeptide 7 (.1) AT2G23220 145 / 6e-41 CYP81D6 "cytochrome P450, family 81, subfamily D, polypeptide 6", cytochrome P450, family 81, subfamily D, polypeptide 6 (.1) AT5G36220 140 / 3e-39 CYP91A1, CYP81D1 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) AT4G37400 135 / 3e-37 CYP81F3 "cytochrome P450, family 81, subfamily F, polypeptide 3", cytochrome P450, family 81, subfamily F, polypeptide 3 (.1) AT4G37320 132 / 4e-36 CYP81D5 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) AT1G66540 129 / 1e-35 Cytochrome P450 superfamily protein (.1.2) AT4G37430 130 / 2e-35 CYP81F1, CYP91A2 "cytochrome P450, family 91, subfamily A, polypeptide 2", CYTOCHROME P450 MONOOXYGENASE 81F1, cytochrome P450, family 91, subfamily A, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020437 [exp] 273 / 7e-90 AT4G37370 630 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10011958 [exp] 165 / 4e-48 AT5G36220 548 / 0.0 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10027614 [exp] 151 / 2e-43 AT4G37370 496 / 6e-174 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Lus10024818 [exp] 131 / 2e-35 AT4G37320 480 / 2e-166 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10024819 [exp] 130 / 5e-35 AT4G37320 493 / 3e-171 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10007221 [exp] 120 / 3e-34 AT4G37340 165 / 4e-49 "cytochrome P450, family 81, subfamily D, polypeptide 3", cytochrome P450, family 81, subfamily D, polypeptide 3 (.1) Lus10024820 [exp] 124 / 7e-33 AT5G36220 493 / 2e-171 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1) Lus10024078 [exp] 118 / 1e-30 AT4G37320 437 / 3e-149 "cytochrome P450, family 81, subfamily D, polypeptide 5", cytochrome P450, family 81, subfamily D, polypeptide 5 (.1) Lus10018717 [exp] 117 / 2e-30 AT4G37370 533 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G050000 [exp] 187 / 4e-57 AT4G37370 509 / 3e-178 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.002G121300 [exp] 143 / 7e-41 AT4G37370 308 / 2e-101 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.008G205200 [exp] 144 / 1e-40 AT4G37370 524 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G008200 [exp] 144 / 2e-40 AT4G37370 531 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G006000 [exp] 142 / 1e-39 AT4G37370 526 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.005G143800 [exp] 142 / 2e-39 AT4G37370 539 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.003G007000 [exp] 142 / 2e-39 AT4G37370 525 / 0.0 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.007G049900 [exp] 140 / 6e-39 AT4G37370 490 / 1e-170 "cytochrome P450, family 81, subfamily D, polypeptide 8", cytochrome P450, family 81, subfamily D, polypeptide 8 (.1) Potri.014G021800 [exp] 138 / 4e-38 AT4G37360 458 / 1e-157 "cytochrome P450, family 81, subfamily D, polypeptide 2", cytochrome P450, family 81, subfamily D, polypeptide 2 (.1) Potri.005G144000 [exp] 137 / 5e-38 AT5G36220 496 / 6e-173 CYTOCHROME P450 91A1, cytochrome P450, family 81, subfamily D, polypeptide 1, cytochrome p450 81d1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10024973 pacid=23148409 polypeptide=Lus10024973 locus=Lus10024973.g ID=Lus10024973.BGIv1.0 annot-version=v1.0 ATGGGTAAGCACATAGGGTACAACCACACCACAATGATGCAAACATCTTACGGGGACCCAATGGCGCAACCTCCGCCGCATCGGCTCCCCCGAGATCTTC TCCGCCCACCGCCTGAACTCCTTCATTTCATTCGTCGAGATGAGGTCAACCGCCTCCTGGTCAGGCTTAGCTCCACGCGCCGGCATGTGCTGAAGTCTAT GTTCCACGAGCTGACGTTCAACACCATGATGAGGATGGTGGCGGGAAAGAGGTTCTACGGTGATGACGTAGAGGATAAGGAGGAGGCAAGGCGGTTCAGC GAGATCATGAAGGAGATGGTGTCTCTCGGCGGGGCGTCCAACCCTGGGGATTTTGTGCCGCTGTTGAGGTGGATGGACGGTGGGAAATTGGAGAAGAGAT TGACGTGGCTGGCTGAGAGAACAGACAGGTTCTTGCAAGGATTGATTGAGGAGCATCGGAGAAAGAAGCAGCATTTGGAGAGAAAGAATACTATGATCGA CCACTTGGTTGCTTTGCAGGAATCTCAACATGAATATTACAGTGACCACATTATTAAAGGCCTTATTCTCATAAGTTTCTTCTTCGATCTTTTCTTCGTT AATTATATTATCTTTGCATATCATATCCAATTATTTATTTTCAAGAATTTATTTGTCATGTGA
AA sequence Show only first row Show all	>Lus10024973 pacid=23148409 polypeptide=Lus10024973 locus=Lus10024973.g ID=Lus10024973.BGIv1.0 annot-version=v1.0 MGKHIGYNHTTMMQTSYGDPMAQPPPHRLPRDLLRPPPELLHFIRRDEVNRLLVRLSSTRRHVLKSMFHELTFNTMMRMVAGKRFYGDDVEDKEEARRFS EIMKEMVSLGGASNPGDFVPLLRWMDGGKLEKRLTWLAERTDRFLQGLIEEHRRKKQHLERKNTMIDHLVALQESQHEYYSDHIIKGLILISFFFDLFFV NYIIFAYHIQLFIFKNLFVM

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G37340		CYP81D3	"cytochrome P450, family 81, s...		Lus10024973 [exp]	0	1
AT5G37590			Tetratricopeptide repeat (TPR)...		Lus10004034 [exp]	2.8	0.8382
AT2G31100			alpha/beta-Hydrolases superfam...		Lus10000983 [exp]	3.3	0.7955
AT1G27180			disease resistance protein (TI...		Lus10000423 [exp]	4.9	0.8160
					Lus10033476 [exp]	5.1	0.8421
AT2G45910			U-box domain-containing protei...		Lus10036363 [exp]	8.9	0.8171
AT3G52420		ATOEP7	outer envelope membrane protei...		Lus10003733 [exp]	9.5	0.8338
AT5G10250		DOT3	DEFECTIVELY ORGANIZED TRIBUTAR...		Lus10026046 [exp]	10.4	0.8282
AT5G04620		BIO4, ATBIOF	biotin 4, biotin F (.1.2)		Lus10009662 [exp]	10.6	0.8124
AT1G04480			Ribosomal protein L14p/L23e fa...		Lus10008065 [exp]	11.7	0.8088
AT5G13700		ATPAO1, APAO	polyamine oxidase 1 (.1)		Lus10041898 [exp]	17.2	0.8083

Compare expression of checked genes

Lus10024973 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.