Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G09815 119 / 6e-36 POLD4 polymerase delta 4 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020362 [exp] 121 / 7e-37 AT1G09815 100 / 3e-28 polymerase delta 4 (.1) Lus10009538 [exp] 119 / 9e-36 AT1G09815 96 / 7e-27 polymerase delta 4 (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.019G042900 [exp] 118 / 1e-35 AT1G09815 152 / 8e-49 polymerase delta 4 (.1) Potri.013G076400 [exp] 114 / 5e-34 AT1G09815 154 / 1e-49 polymerase delta 4 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04081 [flax] [poplar] DNA_pol_delta_4 DNA polymerase delta, subunit 4
Representative CDS sequence Show only first row Show all	>Lus10024978 pacid=23148438 polypeptide=Lus10024978 locus=Lus10024978.g ID=Lus10024978.BGIv1.0 annot-version=v1.0 ATGAAGTCTTACTACAGGCAGAAAAAGACCAACCGGAGTGACGACGTGAGCGGCAAACCCTCATCGTCCTCCAAGTCCATCAAGAAGAAATCACCTGCCG CCGCCACTGTCGGCTCCGGCGTTACTCAACCGCCTGCCTTGATCACTTCTCCCCACGGCGCTACTGATCTCCAAGAGGATGTAGAGAAGAACGAGCAATT TTTTAGAGAATTCGACATGAACATGGCTTACGGGCCTTGCATTGGAATGACGAGGTTAGCTCGATGGGAGCGTGCTCAACGCCTCGGCCTCAACCCTCCT GTTCAAGTCAAGAACCTAATTGATGCCGGGAATGCTCAGACGCAGAGTTTATGGGATGGCCGTGTCTAG
AA sequence Show only first row Show all	>Lus10024978 pacid=23148438 polypeptide=Lus10024978 locus=Lus10024978.g ID=Lus10024978.BGIv1.0 annot-version=v1.0 MKSYYRQKKTNRSDDVSGKPSSSSKSIKKKSPAAATVGSGVTQPPALITSPHGATDLQEDVEKNEQFFREFDMNMAYGPCIGMTRLARWERAQRLGLNPP VQVKNLIDAGNAQTQSLWDGRV

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G09815		POLD4	polymerase delta 4 (.1)		Lus10024978 [exp]	0	1
AT5G05830			RING/FYVE/PHD zinc finger supe...		Lus10021113 [exp]	1.7	0.8533
AT3G22810			Plant protein of unknown funct...		Lus10009509 [exp]	3.7	0.8583
AT5G55590		QRT1	QUARTET 1, Pectin lyase-like s...		Lus10016605 [exp]	4.7	0.8565
AT1G01310			CAP (Cysteine-rich secretory p...		Lus10003990 [exp]	4.7	0.8087
AT4G35230		BSK1	BR-signaling kinase 1 (.1)		Lus10034573 [exp]	6.9	0.8188
AT2G46660		CYP78A6	"cytochrome P450, family 78, s...		Lus10001670 [exp]	7.7	0.8087
AT1G40087			Plant transposase (Ptta/En/Spm...		Lus10007402 [exp]	7.9	0.8118
					Lus10035120 [exp]	8.4	0.8464
AT5G67070		RALFL34	ralf-like 34 (.1)		Lus10003931 [exp]	8.9	0.7885
AT5G02440			unknown protein		Lus10023770 [exp]	11.5	0.7888

Compare expression of checked genes

Lus10024978 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.