Lus10024982 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G33040 130 / 1e-39 Thioredoxin superfamily protein (.1)
AT5G11930 100 / 2e-27 Thioredoxin superfamily protein (.1)
AT1G28480 67 / 7e-15 roxy19, GRX480 Thioredoxin superfamily protein (.1)
AT4G15680 64 / 4e-14 Thioredoxin superfamily protein (.1)
AT4G15690 62 / 3e-13 Thioredoxin superfamily protein (.1)
AT4G15660 61 / 7e-13 Thioredoxin superfamily protein (.1)
AT4G15700 61 / 1e-12 Thioredoxin superfamily protein (.1)
AT4G15670 60 / 2e-12 Thioredoxin superfamily protein (.1)
AT5G18600 57 / 2e-11 Thioredoxin superfamily protein (.1)
AT3G02000 54 / 1e-09 ROXY1 Thioredoxin superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10013519 135 / 6e-42 AT4G33040 115 / 9e-35 Thioredoxin superfamily protein (.1)
Lus10041538 72 / 1e-16 AT5G14070 134 / 3e-41 Thioredoxin superfamily protein (.1)
Lus10035183 69 / 2e-15 AT5G14070 148 / 6e-47 Thioredoxin superfamily protein (.1)
Lus10013962 67 / 8e-15 AT1G28480 135 / 3e-42 Thioredoxin superfamily protein (.1)
Lus10029440 66 / 1e-14 AT3G62930 144 / 4e-46 Thioredoxin superfamily protein (.1)
Lus10005940 63 / 3e-13 AT3G62930 137 / 2e-43 Thioredoxin superfamily protein (.1)
Lus10002887 61 / 1e-12 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1)
Lus10011333 61 / 2e-12 AT5G14070 151 / 1e-47 Thioredoxin superfamily protein (.1)
Lus10033965 60 / 2e-12 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G226900 137 / 3e-42 AT4G33040 184 / 8e-61 Thioredoxin superfamily protein (.1)
Potri.001G325800 70 / 4e-16 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Potri.004G049800 69 / 3e-15 AT1G28480 94 / 2e-25 Thioredoxin superfamily protein (.1)
Potri.003G167000 67 / 6e-15 AT5G14070 150 / 9e-48 Thioredoxin superfamily protein (.1)
Potri.010G021800 66 / 1e-14 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1)
Potri.014G134000 64 / 8e-14 AT3G62930 158 / 8e-52 Thioredoxin superfamily protein (.1)
Potri.001G060600 64 / 1e-13 AT5G14070 147 / 1e-46 Thioredoxin superfamily protein (.1)
Potri.008G214600 63 / 1e-13 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1)
Potri.008G214800 62 / 3e-13 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1)
Potri.002G208700 61 / 1e-12 AT3G62930 157 / 1e-51 Thioredoxin superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0172 Thioredoxin PF00462 Glutaredoxin Glutaredoxin
Representative CDS sequence
>Lus10024982 pacid=23148437 polypeptide=Lus10024982 locus=Lus10024982.g ID=Lus10024982.BGIv1.0 annot-version=v1.0
ATGCAAGGACTAGAGCTCTGTTCAAACGACGACGTCCGCCTCCACCACACCCCTCCTCCTCCGGCTCCCACCACCACCACCACAACAACCTCTGCTTCTC
TGTCAATCGACGCCGTTGAATCCGCGGAGGACCGGATCCAGCGGCTGATATCAGAGAATCCGGTCATCATATTCTCCCGATCTTCCTGTTCTATGTGCCA
CGTCATGAGGAAGCTTCTCGCCACAATCGGCGTCAATCCTACCGTCATCGAGTTGGAAGATCACGAGATCTCTGCTCTACCTTCACCTCCGCCCAACCAA
GATGATTACTCCTCTCCGGTGATTAACCAGCTGTCTCCCTCTGTTTTCATAGGCGGCACATGTGTCGGCGGCCTCGAATCCCTCGTTGGTCTCCACCTCA
GCGGACTCCTTGTTCCTAAGCTTGTCCAAGTTGGGGCTCTATGGGTATGA
AA sequence
>Lus10024982 pacid=23148437 polypeptide=Lus10024982 locus=Lus10024982.g ID=Lus10024982.BGIv1.0 annot-version=v1.0
MQGLELCSNDDVRLHHTPPPPAPTTTTTTTSASLSIDAVESAEDRIQRLISENPVIIFSRSSCSMCHVMRKLLATIGVNPTVIELEDHEISALPSPPPNQ
DDYSSPVINQLSPSVFIGGTCVGGLESLVGLHLSGLLVPKLVQVGALWV

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G33040 Thioredoxin superfamily protei... Lus10024982 0 1
Lus10017869 2.0 0.9477
AT3G59010 PME61, PME35 pectin methylesterase 61 (.1) Lus10025510 2.2 0.9519
AT5G45650 subtilase family protein (.1) Lus10002780 4.9 0.9465
AT1G69120 MADS AGL7, AP1 APETALA1, AGAMOUS-like 7, K-bo... Lus10017871 6.3 0.9160
AT2G04570 GDSL-like Lipase/Acylhydrolase... Lus10031520 6.5 0.9420
AT1G06460 ACD31.2, ACD32.... ALPHA-CRYSTALLIN DOMAIN 31.2, ... Lus10007366 6.9 0.9312
AT5G25610 ATRD22, RD22 RESPONSIVE TO DESSICATION 22, ... Lus10022114 7.7 0.9470
AT3G12685 Acid phosphatase/vanadium-depe... Lus10001756 9.2 0.8908
AT5G18470 Curculin-like (mannose-binding... Lus10003099 9.7 0.9446
AT2G20610 RTY1, RTY, HLS3... SUPERROOT 1, ROOTY 1, ROOTY, H... Lus10018626 10.0 0.9091

Lus10024982 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.