Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74840 56 / 2e-10 MYB Homeodomain-like superfamily protein (.1.2) AT1G19000 49 / 3e-08 MYB Homeodomain-like superfamily protein (.1.2) AT1G70000 45 / 2e-06 MYB myb-like transcription factor family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10036652 [exp] 103 / 2e-28 AT1G74840 176 / 4e-54 Homeodomain-like superfamily protein (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G191800 [exp] 45 / 1e-06 AT1G70000 241 / 5e-79 myb-like transcription factor family protein (.1.2) Potri.012G073900 [exp] 44 / 3e-06 AT1G74840 152 / 2e-44 Homeodomain-like superfamily protein (.1.2) Potri.015G069000 [exp] 40 / 4e-05 AT1G70000 132 / 8e-37 myb-like transcription factor family protein (.1.2)
PFAM info
Representative CDS sequence Show only first row Show all	>Lus10024984 pacid=23148445 polypeptide=Lus10024984 locus=Lus10024984.g ID=Lus10024984.BGIv1.0 annot-version=v1.0 ATGGCTGCTAGCAACACTACTGCCGGTGTCGGCGAGATCATGTTGTTTGAAGTGAGGGTGGTCGTTGATTTCATGAAGAAGAGTGTCAGTCTCAACAATC TTTCCCATTACCAACAGCAGCCTTCTGCAAAAGATAAGGATGAGGTTGTGTCTGCCGCTGGTTACGCTTCCGCAGACGCCGGTCATGACTTCTCTGGTGC CCCTCGCTCCGAGCGGAAGCGAGATTTGTTTTGTGTTTTCTTTACCTACTTTGTTTTTCAATTTGGAATAACAGGAATCCATAGATAA
AA sequence Show only first row Show all	>Lus10024984 pacid=23148445 polypeptide=Lus10024984 locus=Lus10024984.g ID=Lus10024984.BGIv1.0 annot-version=v1.0 MAASNTTAGVGEIMLFEVRVVVDFMKKSVSLNNLSHYQQQPSAKDKDEVVSAAGYASADAGHDFSGAPRSERKRDLFCVFFTYFVFQFGITGIHR

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT1G74840	MYB		Homeodomain-like superfamily p...		Lus10024984 [exp]	0	1
AT2G16980			Major facilitator superfamily ...		Lus10025087 [exp]	15.6	0.7933
AT1G53440			Leucine-rich repeat transmembr...		Lus10038153 [exp]	29.2	0.7883
AT5G35525			PLAC8 family protein (.1)		Lus10035039 [exp]	29.9	0.7849
					Lus10026628 [exp]	31.7	0.7908
AT5G54160		ATOMT1	O-methyltransferase 1 (.1)		Lus10006146 [exp]	39.5	0.7441
AT3G52740			unknown protein		Lus10014197 [exp]	48.7	0.7651
					Lus10030151 [exp]	49.0	0.7603
AT5G46530			AWPM-19-like family protein (....		Lus10015255 [exp]	49.8	0.7549
AT1G25270			nodulin MtN21 /EamA-like trans...		Lus10012693 [exp]	50.1	0.7595
AT3G51760			Protein of unknown function (D...		Lus10022661 [exp]	51.3	0.7124

Compare expression of checked genes

Lus10024984 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.