Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G14610 214 / 1e-66 CYP72A7 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) AT3G14630 211 / 1e-65 CYP72A9 "cytochrome P450, family 72, subfamily A, polypeptide 9", cytochrome P450, family 72, subfamily A, polypeptide 9 (.1) AT2G26710 207 / 9e-64 CYP72B1, CYP734A1, BAS1 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) AT3G14620 206 / 1e-63 CYP72A8 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) AT3G14650 196 / 9e-60 CYP72A11 "cytochrome P450, family 72, subfamily A, polypeptide 11", cytochrome P450, family 72, subfamily A, polypeptide 11 (.1) AT3G14690 196 / 1e-59 CYP72A15 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) AT3G14680 193 / 1e-58 CYP72A14 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) AT3G14640 192 / 5e-58 CYP72A10 "cytochrome P450, family 72, subfamily A, polypeptide 10", cytochrome P450, family 72, subfamily A, polypeptide 10 (.1) AT3G14660 191 / 9e-58 CYP72A13 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) AT2G46950 168 / 1e-48 CYP709B2 "cytochrome P450, family 709, subfamily B, polypeptide 2", cytochrome P450, family 709, subfamily B, polypeptide 2 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042487 [exp] 222 / 2e-69 AT3G14690 604 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10026178 [exp] 213 / 4e-66 AT3G14690 607 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10042486 [exp] 210 / 9e-65 AT3G14690 580 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Lus10033044 [exp] 207 / 2e-63 AT2G26710 803 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10017771 [exp] 205 / 4e-63 AT2G26710 705 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036823 [exp] 176 / 6e-55 AT3G14610 227 / 2e-71 "cytochrome P450, family 72, subfamily A, polypeptide 7", cytochrome P450, family 72, subfamily A, polypeptide 7 (.1) Lus10019184 [exp] 181 / 9e-54 AT3G14680 369 / 2e-122 "cytochrome P450, family 72, subfamily A, polypeptide 14", cytochrome P450, family 72, subfamily A, polypeptide 14 (.1) Lus10002108 [exp] 180 / 2e-53 AT2G26710 353 / 1e-116 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Lus10036942 [exp] 183 / 9e-53 AT2G26710 375 / 2e-119 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G117700 [exp] 253 / 2e-83 AT3G14620 368 / 9e-125 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.011G117600 [exp] 253 / 7e-82 AT3G14620 479 / 7e-166 "cytochrome P450, family 72, subfamily A, polypeptide 8", cytochrome P450, family 72, subfamily A, polypeptide 8 (.1) Potri.011G098800 [exp] 215 / 7e-67 AT3G14690 640 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.018G070900 [exp] 215 / 8e-67 AT2G26710 796 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.006G154500 [exp] 214 / 2e-66 AT2G26710 789 / 0.0 PHYB ACTIVATION TAGGED SUPPRESSOR 1, Cytochrome P450 superfamily protein (.1) Potri.011G101500 [exp] 212 / 1e-65 AT3G14690 609 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099200 [exp] 207 / 2e-65 AT3G14660 466 / 3e-163 "cytochrome P450, family 72, subfamily A, polypeptide 13", cytochrome P450, family 72, subfamily A, polypeptide 13 (.1) Potri.011G099400 [exp] 209 / 2e-64 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G101401 [exp] 208 / 2e-64 AT3G14690 613 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1) Potri.011G099800 [exp] 208 / 2e-64 AT3G14690 612 / 0.0 "cytochrome P450, family 72, subfamily A, polypeptide 15", cytochrome P450, family 72, subfamily A, polypeptide 15 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF00067 [flax] [poplar] p450 Cytochrome P450
Representative CDS sequence Show only first row Show all	>Lus10025006 pacid=23148423 polypeptide=Lus10025006 locus=Lus10025006.g ID=Lus10025006.BGIv1.0 annot-version=v1.0 ATGAGTTTGCAGAAGGGAGAGATTGGGAGCAACAACATTGACTTGTTGGGACTGCTTTTGAAGTGGAGAGACGAGGCAAACATGGAGGAGATCACAATTG ATGACGTAGTTGAAGAATGCAAGCTGTTCTACTTTGCAGGACAGGAGACCACCGCCCATTGGCTGACCTGGACACTAATTTCTCTTTCAATGCATCCTCA ATGGCAACACAAGGCCAGAGATGAAGTGTTACATCTCTGCGGGAGCAACAGCAAACCAACCCAAAATGACATCAACCAACTCAAAACCGTGACGATGATG ATGAACGAGGTGCACAGATTATACCCAATAGTGCCACTCATGTTCAGACAAAGTGGCAAGGAAACAAACATTGCGGGGATGAGGATTCCAGCAGGGGTGG AACTTCTGCTACCGATAATGTTCCTACATTATGATACTAAGTATTGGGGAGATGATGCACAAGAGTTCGAGCCAGACAGGTCTGCACAAGGCGTGTCCAA GGCAGGAATAAACGAACAGCATCCTGCATTTTACCCATTTGGTTGGGGACCTAGGATATGCTTGGGCCGGAATTTTGCTGTTATGGAAACTAAATTGGCA CTGGCTACCATCCTGCAGCAGTTTTGGTTTGAACTTTCACCTTCCTACAGTCATTCTCCATGTTCTTGGAGTGACAAAAATGCAATAACCAAAAGTGTAG GTGTTTGGAAAAATAAAATCTGA
AA sequence Show only first row Show all	>Lus10025006 pacid=23148423 polypeptide=Lus10025006 locus=Lus10025006.g ID=Lus10025006.BGIv1.0 annot-version=v1.0 MSLQKGEIGSNNIDLLGLLLKWRDEANMEEITIDDVVEECKLFYFAGQETTAHWLTWTLISLSMHPQWQHKARDEVLHLCGSNSKPTQNDINQLKTVTMM MNEVHRLYPIVPLMFRQSGKETNIAGMRIPAGVELLLPIMFLHYDTKYWGDDAQEFEPDRSAQGVSKAGINEQHPAFYPFGWGPRICLGRNFAVMETKLA LATILQQFWFELSPSYSHSPCSWSDKNAITKSVGVWKNKI

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G14610		CYP72A7	"cytochrome P450, family 72, s...		Lus10025006 [exp]	0	1
					Lus10002304 [exp]	1.0	0.9702
AT4G26140		BGAL12	beta-galactosidase 12 (.1.2)		Lus10028848 [exp]	2.8	0.9641
AT5G03810			GDSL-like Lipase/Acylhydrolase...		Lus10040791 [exp]	3.0	0.9409
AT3G22600			Bifunctional inhibitor/lipid-t...		Lus10041197 [exp]	5.9	0.9321
AT4G25300			2-oxoglutarate (2OG) and Fe(II...		Lus10004581 [exp]	6.0	0.9337
AT4G10160			RING/U-box superfamily protein...		Lus10016924 [exp]	6.0	0.8973
AT2G37370			unknown protein		Lus10025285 [exp]	6.3	0.8972
AT1G02400		ATGA2OX4, ATGA2...	DOWNSTREAM TARGET OF AGL15 1, ...		Lus10025016 [exp]	6.5	0.9215
AT3G43240	ARID		ARID/BRIGHT DNA-binding domain...		Lus10027658 [exp]	7.1	0.8599
AT1G79450		ALIS5	ALA-interacting subunit 5 (.1....		Lus10033283 [exp]	11.2	0.9054

Compare expression of checked genes

Lus10025006 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.