Lus10025007 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G06520 47 / 1e-07 PSBX photosystem II subunit X (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026458 120 / 2e-36 AT2G06520 74 / 3e-18 photosystem II subunit X (.1)
Lus10033434 65 / 1e-14 AT2G06520 93 / 1e-25 photosystem II subunit X (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G222300 62 / 2e-13 AT2G06520 80 / 2e-20 photosystem II subunit X (.1)
Potri.018G065200 62 / 2e-13 AT2G06520 100 / 1e-28 photosystem II subunit X (.1)
Potri.006G144000 61 / 4e-13 AT2G06520 97 / 6e-27 photosystem II subunit X (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Representative CDS sequence
>Lus10025007 pacid=23148406 polypeptide=Lus10025007 locus=Lus10025007.g ID=Lus10025007.BGIv1.0 annot-version=v1.0
ATGGCGACAGTATCAATGCCGGTTATTCCGCTGATGACTTCAGGGCCAGCAAAAGCAGAGAGGACTAGGTCAGCGGTGAAATCTTTCTCCTCAAAAGCAG
GTGCTTACAGTTCGAGAAGCAGCGGCCGACGGTCATTCCGAGTAGAGGCGTCGCTGAAAGAGAGGGTTTTGGGAGGCGTAGGTGCGGCGGCAGTAGCAGC
TTCGATGGTGATGCCAGATGTGGCAGTAGCAGCAGAATACACCCTAACACCATCTCTCAAGAACTTCTTGCTCAGCATTGCTGCTGGTACTTTCGTCCTT
AGCGCTATTGCTGGTGCTATTATTGGCGTCTCCAACTTCGACCCTGTCAAGCGTGCCTGA
AA sequence
>Lus10025007 pacid=23148406 polypeptide=Lus10025007 locus=Lus10025007.g ID=Lus10025007.BGIv1.0 annot-version=v1.0
MATVSMPVIPLMTSGPAKAERTRSAVKSFSSKAGAYSSRSSGRRSFRVEASLKERVLGGVGAAAVAASMVMPDVAVAAEYTLTPSLKNFLLSIAAGTFVL
SAIAGAIIGVSNFDPVKRA

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G06520 PSBX photosystem II subunit X (.1) Lus10025007 0 1
AT2G06520 PSBX photosystem II subunit X (.1) Lus10026458 1.0 0.9811
AT2G30570 PSBW photosystem II reaction center... Lus10033862 2.0 0.9574
AT2G34430 LHCB1.4, LHB1B1 light-harvesting chlorophyll-p... Lus10023320 3.2 0.9465
AT1G15820 CP24, LHCB6 light harvesting complex photo... Lus10015831 3.5 0.9498
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Lus10001369 4.9 0.9439
AT5G18660 PCB2, DVR PALE-GREEN AND CHLOROPHYLL B R... Lus10037912 6.3 0.9385
AT1G55670 PSAG photosystem I subunit G (.1) Lus10017476 7.2 0.9487
AT1G60950 FED A, ATFD2, F... FERREDOXIN 2, 2Fe-2S ferredoxi... Lus10015462 7.5 0.9439
AT3G16000 MFP1 MAR binding filament-like prot... Lus10025768 7.9 0.9212
AT1G51400 Photosystem II 5 kD protein (.... Lus10030132 15.7 0.9239

Lus10025007 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.