Lus10025014 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G64320 70 / 1e-14 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G63330 66 / 4e-13 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT3G53700 66 / 5e-13 MEE40 maternal effect embryo arrest 40, Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT5G14770 65 / 6e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G12300 65 / 6e-13 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63150 63 / 3e-12 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT1G63080 62 / 6e-12 Pentatricopeptide repeat (PPR) superfamily protein (.1)
AT1G62590 62 / 7e-12 pentatricopeptide (PPR) repeat-containing protein (.1)
AT1G63130 61 / 2e-11 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
AT5G12100 61 / 2e-11 pentatricopeptide (PPR) repeat-containing protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10026465 260 / 1e-85 AT1G05670 197 / 6e-55 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Lus10042529 73 / 2e-15 AT5G65560 498 / 1e-160 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10023863 69 / 2e-14 AT5G12100 728 / 0.0 pentatricopeptide (PPR) repeat-containing protein (.1)
Lus10014660 67 / 2e-13 AT3G04760 522 / 3e-180 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10000554 67 / 2e-13 AT3G04760 535 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10021989 67 / 2e-13 AT5G65560 498 / 2e-157 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10032789 64 / 9e-13 AT1G09820 250 / 4e-78 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Lus10013832 64 / 1e-12 AT2G17140 1034 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Lus10005540 63 / 5e-12 AT5G18475 562 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G223300 134 / 2e-37 AT1G05670 208 / 1e-58 Pentatricopeptide repeat (PPR-like) superfamily protein (.1), Pentatricopeptide repeat (PPR-like) superfamily protein (.2)
Potri.005G050240 79 / 1e-17 AT1G12700 465 / 1e-155 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.013G032600 77 / 3e-17 AT1G12700 493 / 2e-166 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046000 76 / 1e-16 AT1G63130 405 / 9e-133 Tetratricopeptide repeat (TPR)-like superfamily protein (.1)
Potri.005G050300 74 / 5e-16 AT1G12700 466 / 5e-156 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050500 74 / 6e-16 AT1G12700 523 / 2e-178 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G046200 73 / 9e-16 AT1G12700 501 / 5e-170 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050120 72 / 1e-15 AT1G12700 295 / 3e-94 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.005G050180 71 / 4e-15 AT1G12700 488 / 2e-164 RNA processing factor 1, ATP binding;nucleic acid binding;helicases (.1)
Potri.017G131400 69 / 2e-14 AT1G09680 669 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0020 TPR PF01535 PPR PPR repeat
Representative CDS sequence
>Lus10025014 pacid=23148457 polypeptide=Lus10025014 locus=Lus10025014.g ID=Lus10025014.BGIv1.0 annot-version=v1.0
ATGGAGGTGGGAGAGCTTAGCTTGGCAACGTATGTTCTAAAGCAAATGAAGAAGATGGGGGGGTGCAACCCAAATTTCATATCGTATCGCACAGTGATAT
CTAACCTTAGTAAGAGCAGTGGTTGTATGAAGGAAGCAGAGAAGATTGTCAAAGATATGGTCTCAGACGGAGTTCCTATGGACGCAAGCATTTACAGTTG
TTTAATTTATGGATATTGCGAGGCAGGAGATGTCAGAATGGCAACCAAAGTTTTCCATGAAGCGATTAAGAAGGGGTGCGTTGTCAGCTTAGAGGCTTTT
ACAGCGTTCATCAAACGGTTAATAAGTGAAAAGAAGGAAGTAATTGGTGCTGAGAATCTGTTGAAAGAGATGTGTAAGAGATGTGTTGTTGCTGAAACTG
CTGGCTATCGGCAAGTCCTCGATGGCTACATGGGAATCGGCCCCTAG
AA sequence
>Lus10025014 pacid=23148457 polypeptide=Lus10025014 locus=Lus10025014.g ID=Lus10025014.BGIv1.0 annot-version=v1.0
MEVGELSLATYVLKQMKKMGGCNPNFISYRTVISNLSKSSGCMKEAEKIVKDMVSDGVPMDASIYSCLIYGYCEAGDVRMATKVFHEAIKKGCVVSLEAF
TAFIKRLISEKKEVIGAENLLKEMCKRCVVAETAGYRQVLDGYMGIGP

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G64320 Pentatricopeptide repeat (PPR)... Lus10025014 0 1
Lus10032893 3.9 0.7550
AT2G20540 MEF21 mitochondrial editing factor ... Lus10030125 7.4 0.6996
AT5G63310 NDPK1A, NDPKIAI... NDP KINASE 1A, NUCLEOSIDE DIPH... Lus10017931 9.2 0.7396
AT3G60520 unknown protein Lus10042880 9.2 0.7326
AT3G61110 ARS27A ribosomal protein S27 (.1) Lus10035128 26.8 0.7166
AT1G66520 PDE194 pigment defective 194, formylt... Lus10010978 27.1 0.7094
AT4G21065 Tetratricopeptide repeat (TPR)... Lus10006628 33.0 0.6720
AT5G28460 Pentatricopeptide repeat (PPR)... Lus10018279 42.4 0.7005
AT5G59500 protein C-terminal S-isoprenyl... Lus10004974 60.2 0.6930
AT5G05800 unknown protein Lus10007443 63.5 0.6289

Lus10025014 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.