Plant FIBer expression Database

Lus10025018 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G01940 79 / 1e-18 ATCNFU1, NFU1 NFU domain protein 1 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10009999
[exp]
125 / 1e-36 AT4G01940 257 / 8e-87 NFU domain protein 1 (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.002G192200
[exp]
81 / 9e-20 AT4G01940 263 / 1e-89 NFU domain protein 1 (.1)
Potri.014G117700
[exp]
81 / 1e-19 AT4G01940 248 / 1e-83 NFU domain protein 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0232 NifU PF01106 NifU NifU-like domain
Representative CDS sequence
>Lus10025018 pacid=23148455 polypeptide=Lus10025018 locus=Lus10025018.g ID=Lus10025018.BGIv1.0 annot-version=v1.0
ATGGCGTCCATGGCGTCCGCTGCAATATCCATGGTTCAACCTCCTCGTCATCGTGCTGTTATTACTGCATCTAGTTCCATCAACCGTCAGTTTCCACGAG
CCATTAGATTACTTCCGAACCACGGTGGAAGAAGAGGAAGGATACTTGTGTTCAACGGGAATCGTGGATCCCCGATTCGCGCTGCCGCAAATTCAAGTAC
AGATACGCCGGTTCTACATCGTTATCTCCGGGCTGTGAATGGCCATCTCGAAATTCTACGACCAGCCATCCAGAACTGCGGTGGGAGTGTGGATGTGGTA
TCAATTGAGGGTGGTAAATGTCAGGTAAGATACACAGGAACCGAGTCTATTGGGTCAGGAGTCAAAGCAGCAATCAAGGAGAAGTCCCAGATATAA
AA sequence
>Lus10025018 pacid=23148455 polypeptide=Lus10025018 locus=Lus10025018.g ID=Lus10025018.BGIv1.0 annot-version=v1.0
MASMASAAISMVQPPRHRAVITASSSINRQFPRAIRLLPNHGGRRGRILVFNGNRGSPIRAAANSSTDTPVLHRYLRAVNGHLEILRPAIQNCGGSVDVV
SIEGGKCQVRYTGTESIGSGVKAAIKEKSQI

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G01940 ATCNFU1, NFU1 NFU domain protein 1 (.1) Lus10025018
[exp]
0 1
AT5G15340 Pentatricopeptide repeat (PPR)... Lus10014653
[exp]
10.8 0.8476
AT5G12230 MED19A unknown protein Lus10002150
[exp]
15.2 0.8540
AT1G17970 RING/U-box superfamily protein... Lus10034644
[exp]
17.8 0.8448
AT3G01800 Ribosome recycling factor (.1) Lus10035226
[exp]
20.0 0.8003
AT1G70650 Ran BP2/NZF zinc finger-like s... Lus10032790
[exp]
24.7 0.8189
AT3G05675 BTB/POZ domain-containing prot... Lus10013580
[exp]
25.4 0.8365
AT1G53600 Tetratricopeptide repeat (TPR)... Lus10042207
[exp]
32.0 0.8111
AT4G36720 HVA22K HVA22-like protein K (.1) Lus10010093
[exp]
37.7 0.8303
AT4G35530 phosphatidylinositolglycan-rel... Lus10002922
[exp]
38.2 0.8110
AT3G52640 Zn-dependent exopeptidases sup... Lus10007387
[exp]
38.7 0.8359

Lus10025018 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.