Lus10025020 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025020 pacid=23148424 polypeptide=Lus10025020 locus=Lus10025020.g ID=Lus10025020.BGIv1.0 annot-version=v1.0
ATGATACCTGAAGCTGAAGCTGGAAAACTGGAAGCTAACTCAATCTTGACTCTGAACGGCTCAGGTGATGGAAATGAGCACCGGAACGAACTAAAAAGAA
AGGCCTGGCCGGAGAATAACGCTGACCAGACGACAGCGACGCAGCGGCGGGCTGAAGAATCGCTCCAGTTTTACAGTAGGTTTAAGGCCTACGACACAGC
AGAAGTGGCCCGGCCCAATTTCATGAGCCCCAGTGTGGTTGTTGCTGCTGCTGCAGATCAACATTTTGCCATCTTTTTCCTTTTCCCGATAATTATTGCC
ACAACTGCTGGGTCTTTACAGATGGCGACAACAGCTACAATAATGGTAGAGGAGATGTCTCTCTCATTAGTTGATCAGTCGGAGAAGCTGCGTTTATTGG
TGGGGCTCGTTGATGTCTCATCTTACGAGCTATTTCTAGTGGGTATTATATCTCACTAA
AA sequence
>Lus10025020 pacid=23148424 polypeptide=Lus10025020 locus=Lus10025020.g ID=Lus10025020.BGIv1.0 annot-version=v1.0
MIPEAEAGKLEANSILTLNGSGDGNEHRNELKRKAWPENNADQTTATQRRAEESLQFYSRFKAYDTAEVARPNFMSPSVVVAAAADQHFAIFFLFPIIIA
TTAGSLQMATTATIMVEEMSLSLVDQSEKLRLLVGLVDVSSYELFLVGIISH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025020 0 1
AT4G13450 Adenine nucleotide alpha hydro... Lus10023716 4.8 0.8405
AT2G45910 U-box domain-containing protei... Lus10018835 15.0 0.8076
AT4G17030 ATHEXPBETA3.1, ... expansin-like B1 (.1) Lus10001010 18.3 0.7976
AT5G35390 Leucine-rich repeat protein ki... Lus10022946 19.0 0.7464
Lus10005948 19.4 0.7440
Lus10007802 19.7 0.7984
AT2G34930 disease resistance family prot... Lus10029483 20.2 0.7499
AT4G13450 Adenine nucleotide alpha hydro... Lus10014459 21.2 0.7708
AT5G44120 ATCRA1, CRU1, C... CRUCIFERINA, RmlC-like cupins ... Lus10022929 21.3 0.7963
AT2G31420 B3 Domain of unknown function (DU... Lus10039058 22.6 0.7759

Lus10025020 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.