Lus10025028 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G61310 99 / 1e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
AT5G40382 86 / 2e-24 Cytochrome c oxidase subunit Vc family protein (.1)
AT2G47380 80 / 4e-22 Cytochrome c oxidase subunit Vc family protein (.1)
AT3G62400 40 / 8e-06 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10002429 124 / 1e-39 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Lus10010008 124 / 1e-39 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Lus10001454 124 / 1e-39 AT5G61310 101 / 2e-30 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Lus10040012 112 / 1e-34 AT5G61310 99 / 2e-29 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Lus10022249 85 / 5e-24 AT5G40382 91 / 3e-26 Cytochrome c oxidase subunit Vc family protein (.1)
Lus10008765 79 / 2e-21 AT5G40382 92 / 6e-27 Cytochrome c oxidase subunit Vc family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G120500 105 / 5e-32 AT5G61310 103 / 3e-31 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
Potri.002G195901 103 / 1e-31 AT5G61310 94 / 2e-27 Cytochrome c oxidase subunit Vc family protein (.1.2.3.4)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
Representative CDS sequence
>Lus10025028 pacid=23148458 polypeptide=Lus10025028 locus=Lus10025028.g ID=Lus10025028.BGIv1.0 annot-version=v1.0
ATGGCCGGCAGGATTCCACACCCGACACTGACAGGTCCGAGCGTCATCAAGGAAATAGTCATCGGGTTTGCACTCGGTATGGCTGCTGGTGGCCTCTGGA
AGATGCACCACTGGAACGAGCAGAGGAAAGTGAGAGCATTCTACGACATGCTTGAGAAAGGTGAAATCAGTGTTGTTGCTGAAGAATAG
AA sequence
>Lus10025028 pacid=23148458 polypeptide=Lus10025028 locus=Lus10025028.g ID=Lus10025028.BGIv1.0 annot-version=v1.0
MAGRIPHPTLTGPSVIKEIVIGFALGMAAGGLWKMHHWNEQRKVRAFYDMLEKGEISVVAEE

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT5G61310 Cytochrome c oxidase subunit V... Lus10025028 0 1
AT5G61310 Cytochrome c oxidase subunit V... Lus10002429 1.0 0.8865
AT1G21900 emp24/gp25L/p24 family/GOLD fa... Lus10041939 1.4 0.8791
AT1G75270 DHAR2 dehydroascorbate reductase 2 (... Lus10023441 4.1 0.7886
AT5G67490 unknown protein Lus10000389 4.5 0.8301
AT5G55290 ATPase, V0 complex, subunit E ... Lus10032570 4.6 0.8447
AT5G54750 Transport protein particle (TR... Lus10028720 5.5 0.8267
AT1G07960 ATPDIL5-1 PDI-like 5-1 (.1.2.3) Lus10036125 8.7 0.8308
AT1G50740 Transmembrane proteins 14C (.1... Lus10019624 9.0 0.8116
AT4G01897 unknown protein Lus10038061 9.5 0.7912
AT3G52730 ubiquinol-cytochrome C reducta... Lus10017043 9.8 0.7840

Lus10025028 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.