Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G60540 78 / 1e-20 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) AT2G45070 77 / 2e-20 SEC61 BETA, SEC61BETA SUPPRESSORS OF SECRETION-DEFECTIVE 61 BETA, Preprotein translocase Sec, Sec61-beta subunit protein (.1.2.3.4) AT5G60460 63 / 1e-14 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10011428 [exp] 90 / 3e-25 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10037570 [exp] 90 / 3e-25 AT3G60540 105 / 8e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10010009 [exp] 90 / 3e-25 AT3G60540 109 / 3e-33 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Lus10036119 [exp] 60 / 3e-13 AT5G60460 108 / 6e-32 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.002G143100 [exp] 87 / 4e-24 AT3G60540 86 / 1e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.014G059000 [exp] 85 / 2e-23 AT3G60540 81 / 7e-22 Preprotein translocase Sec, Sec61-beta subunit protein (.1.2) Potri.009G012000 [exp] 59 / 7e-13 AT5G60460 86 / 6e-23 Preprotein translocase Sec, Sec61-beta subunit protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03911 [flax] [poplar] Sec61_beta Sec61beta family
Representative CDS sequence Show only first row Show all	>Lus10025029 pacid=23148431 polypeptide=Lus10025029 locus=Lus10025029.g ID=Lus10025029.BGIv1.0 annot-version=v1.0 ATGGCTTTAGGTGGTGGAACAGCTCCCCCGAGAGGAAGCGCAGCAGCTGCTGCGAGCATGCGCAGGAGGAGGACCACCAGTGGGGGTGCGACAGGAGGAG GAGCCGCAGGAACAATGCTCCAGTTCTACACCAATGATGCGCCGGGGCTGAAGATATCTCCTAACGTAGTCCTTTTTATGAGCATCGGTTTCATCGCGTT CGTTGCCGTTCTCCATGTTGTCGGTAAGATATACATTGTCCGGAGGGAGGCTTGA
AA sequence Show only first row Show all	>Lus10025029 pacid=23148431 polypeptide=Lus10025029 locus=Lus10025029.g ID=Lus10025029.BGIv1.0 annot-version=v1.0 MALGGGTAPPRGSAAAAASMRRRRTTSGGATGGGAAGTMLQFYTNDAPGLKISPNVVLFMSIGFIAFVAVLHVVGKIYIVRREA

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT3G60540			Preprotein translocase Sec, Se...		Lus10025029 [exp]	0	1
AT1G59710			Protein of unknown function (D...		Lus10013281 [exp]	2.0	0.8755
AT4G21380		ARK3	receptor kinase 3 (.1)		Lus10037733 [exp]	2.8	0.8646
					Lus10024821 [exp]	6.7	0.8401
AT4G05000		VPS28-2, VPS28-...	vacuolar protein sorting-assoc...		Lus10018442 [exp]	11.8	0.8309
AT2G36900		ATMEMB11, MEMB1...	membrin 11 (.1.2)		Lus10005690 [exp]	12.0	0.8317
AT5G16110			unknown protein		Lus10028474 [exp]	13.9	0.8400
AT5G04850		VPS60.2	SNF7 family protein (.1.2)		Lus10028867 [exp]	13.9	0.8272
AT5G16110			unknown protein		Lus10009170 [exp]	14.1	0.8157
AT5G04550			Protein of unknown function (D...		Lus10008987 [exp]	18.7	0.8074
AT4G31270	Trihelix		sequence-specific DNA binding ...		Lus10020182 [exp]	18.7	0.7863

Compare expression of checked genes

Lus10025029 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.