Lus10025043 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G02120 217 / 1e-68 CTP synthase family protein (.1)
AT3G12670 206 / 4e-64 EMB2742 embryo defective 2742, CTP synthase family protein (.1)
AT1G30820 204 / 1e-63 CTP synthase family protein (.1)
AT4G20320 192 / 9e-59 CTP synthase family protein (.1.2)
AT2G34890 190 / 4e-58 CTP synthase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010020 160 / 1e-47 AT4G02120 624 / 0.0 CTP synthase family protein (.1)
Lus10001218 152 / 7e-44 AT1G30820 894 / 0.0 CTP synthase family protein (.1)
Lus10038403 152 / 8e-44 AT1G30820 897 / 0.0 CTP synthase family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.014G123200 226 / 3e-71 AT4G02120 918 / 0.0 CTP synthase family protein (.1)
Potri.008G080100 211 / 4e-66 AT3G12670 929 / 0.0 embryo defective 2742, CTP synthase family protein (.1)
Potri.010G176500 211 / 4e-66 AT3G12670 935 / 0.0 embryo defective 2742, CTP synthase family protein (.1)
Potri.001G073100 211 / 1e-65 AT1G30820 901 / 0.0 CTP synthase family protein (.1)
Potri.003G157900 210 / 2e-65 AT1G30820 910 / 0.0 CTP synthase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0023 P-loop_NTPase PF06418 CTP_synth_N CTP synthase N-terminus
Representative CDS sequence
>Lus10025043 pacid=23148447 polypeptide=Lus10025043 locus=Lus10025043.g ID=Lus10025043.BGIv1.0 annot-version=v1.0
ATGGAAGCTGAAAGGAAGATGAAGTACGTGCTGGTGAGCGGAGGTGTTGTCAGTGGCCTTGGCAAGGGCGTCACAGCTAGCAGCGTCGGCGTCGTCCTCA
AAGCTTGCGGCCTTGGTGTCACCTCCATCAAAATAGATCCTTACTTGAATACTGATGCTGGTACCATGTCTCCTTTTGAGCACGGGGAGGTTTTTGTTCT
TGATGACGGCGGAGAGGTTGACTTGGATTTGGGTAACTACGAGCGTTTCCTCGATGTGACACTCACCAAAGACAATAACATCACAACTGGGAAGATATTT
CAGTCTGTTATTGAGAAGGAAAGGAGAGGGGATTATCTTGGAAAGACTGTTCAGGTGGTACCTCACGTCACTGATGCCATCAGGAACTGGATTGAGTCAG
TTGCTACGATTCCTGTAGAGGGGAAGGAAGGCCCTGCTGACGTATGTGTGATAGAATTGGGAGGAACTGTGGGCGAGTCCTGA
AA sequence
>Lus10025043 pacid=23148447 polypeptide=Lus10025043 locus=Lus10025043.g ID=Lus10025043.BGIv1.0 annot-version=v1.0
MEAERKMKYVLVSGGVVSGLGKGVTASSVGVVLKACGLGVTSIKIDPYLNTDAGTMSPFEHGEVFVLDDGGEVDLDLGNYERFLDVTLTKDNNITTGKIF
QSVIEKERRGDYLGKTVQVVPHVTDAIRNWIESVATIPVEGKEGPADVCVIELGGTVGES

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT4G02120 CTP synthase family protein (.... Lus10025043 0 1
AT2G44950 RDO4, HUB1 REDUCED DORMANCY 4, histone mo... Lus10028187 4.0 0.9131
AT4G18465 RNA helicase family protein (.... Lus10025127 5.2 0.9041
AT2G35720 OWL1 ORIENTATION UNDER VERY LOW FLU... Lus10008515 6.5 0.8851
AT5G46680 Pentatricopeptide repeat (PPR-... Lus10039036 6.6 0.8986
AT4G02120 CTP synthase family protein (.... Lus10025042 6.9 0.9161
AT5G23740 RPS11-BETA ribosomal protein S11-beta (.1... Lus10008806 7.9 0.8515
AT5G67530 ATPUB49 plant U-box 49 (.1) Lus10004731 9.9 0.8851
AT1G31970 STRS1 STRESS RESPONSE SUPPRESSOR 1, ... Lus10004552 10.4 0.8867
AT2G29190 APUM2 pumilio 2 (.1.2) Lus10016513 11.5 0.8504
AT5G62600 MOS14 modifier of snc1-1, 14, ARM re... Lus10004250 11.8 0.8790

Lus10025043 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.