Lus10025049 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G16700 232 / 7e-80 ADF5, ATADF5 actin depolymerizing factor 5 (.1.2)
AT4G34970 229 / 9e-79 ADF9 actin depolymerizing factor 9 (.1)
AT2G31200 184 / 6e-61 ADF6, ATADF6 actin depolymerizing factor 6 (.1)
AT4G00680 184 / 6e-61 ADF8 actin depolymerizing factor 8 (.1)
AT1G01750 182 / 4e-60 ADF11 actin depolymerizing factor 11 (.1)
AT4G25590 178 / 2e-58 ADF7 actin depolymerizing factor 7 (.1)
AT5G59890 177 / 3e-58 ADF4, ATADF4 actin depolymerizing factor 4 (.1.2)
AT3G46010 176 / 1e-57 ATADF1, ADF1 actin depolymerizing factor 1 (.1.2)
AT5G59880 172 / 2e-56 ADF3 actin depolymerizing factor 3 (.1.2)
AT3G46000 171 / 5e-56 ADF2 actin depolymerizing factor 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034494 242 / 3e-84 AT4G34970 202 / 2e-68 actin depolymerizing factor 9 (.1)
Lus10024418 189 / 7e-63 AT5G59890 249 / 6e-87 actin depolymerizing factor 4 (.1.2)
Lus10022933 189 / 1e-62 AT2G31200 254 / 9e-89 actin depolymerizing factor 6 (.1)
Lus10024417 185 / 3e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10025319 185 / 3e-61 AT3G46010 250 / 3e-87 actin depolymerizing factor 1 (.1.2)
Lus10024885 183 / 1e-60 AT2G31200 230 / 3e-79 actin depolymerizing factor 6 (.1)
Lus10008489 167 / 4e-54 AT1G01750 192 / 2e-64 actin depolymerizing factor 11 (.1)
Lus10027474 165 / 2e-53 AT5G52360 244 / 6e-85 actin depolymerizing factor 10 (.1)
Lus10023428 171 / 4e-53 AT5G59890 244 / 4e-81 actin depolymerizing factor 4 (.1.2)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G133100 257 / 1e-89 AT2G16700 257 / 7e-90 actin depolymerizing factor 5 (.1.2)
Potri.004G173800 255 / 7e-89 AT2G16700 255 / 4e-89 actin depolymerizing factor 5 (.1.2)
Potri.005G223800 193 / 3e-64 AT2G31200 225 / 5e-77 actin depolymerizing factor 6 (.1)
Potri.001G236700 181 / 7e-60 AT5G59890 256 / 2e-89 actin depolymerizing factor 4 (.1.2)
Potri.002G038800 181 / 8e-60 AT2G31200 241 / 2e-83 actin depolymerizing factor 6 (.1)
Potri.009G028100 179 / 7e-59 AT5G59890 256 / 1e-89 actin depolymerizing factor 4 (.1.2)
Potri.008G052100 179 / 8e-59 AT5G59890 249 / 1e-86 actin depolymerizing factor 4 (.1.2)
Potri.009G028200 178 / 9e-59 AT5G59890 258 / 4e-90 actin depolymerizing factor 4 (.1.2)
Potri.001G236400 177 / 2e-58 AT5G59890 246 / 1e-85 actin depolymerizing factor 4 (.1.2)
Potri.015G144500 177 / 2e-58 AT4G25590 257 / 6e-90 actin depolymerizing factor 7 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0092 ADF PF00241 Cofilin_ADF Cofilin/tropomyosin-type actin-binding protein
Representative CDS sequence
>Lus10025049 pacid=23167734 polypeptide=Lus10025049 locus=Lus10025049.g ID=Lus10025049.BGIv1.0 annot-version=v1.0
ATGGCGATGGCTTTCAAAATGGCGGCGAGCGGGATGTGGGTGAGCGACGAGTGCAGGAACTCGTTCATGGCGATGAAGTGGAAGAAGTCCCACCGCTACA
TAGTCTTCAAGATCGACGAGAAGACCGGCCTAGTCGCCGTCGACAAGGTTGGCGGCCCGGGGGAGAGCTACGACGACCTCGCCGCCTCCTTGCCCGACGA
CGACTGCCGCTACGCCGTCTTTGATTTCGACTTCGTCACCGTCGACAACTGCCACAAGAGCAAGATCTTCTTCATTGCCTGGGCACCGGCTGCGTCGAGG
ATCAGAGCAAAGATGATGTACGCGACATCGAAGATCGGAGTGAAGGGAGCATTGGATGGGATCCATTACGAGCTTCAAGCGACCGACCCGACTGAAATGG
GGTTCGACGTGATCAAGAATCAAGCCAAGTGA
AA sequence
>Lus10025049 pacid=23167734 polypeptide=Lus10025049 locus=Lus10025049.g ID=Lus10025049.BGIv1.0 annot-version=v1.0
MAMAFKMAASGMWVSDECRNSFMAMKWKKSHRYIVFKIDEKTGLVAVDKVGGPGESYDDLAASLPDDDCRYAVFDFDFVTVDNCHKSKIFFIAWAPAASR
IRAKMMYATSKIGVKGALDGIHYELQATDPTEMGFDVIKNQAK

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G16700 ADF5, ATADF5 actin depolymerizing factor 5 ... Lus10025049 0 1
AT4G34970 ADF9 actin depolymerizing factor 9 ... Lus10034494 1.7 0.8124
AT5G13170 SAG29, SWEET15,... senescence-associated gene 29 ... Lus10043190 2.6 0.7573
Lus10007992 3.6 0.8203
AT5G65660 hydroxyproline-rich glycoprote... Lus10032818 4.9 0.8128
AT1G15520 ATABCG40, ABCG4... Arabidopsis thaliana ATP-bindi... Lus10022663 5.7 0.8050
AT5G23850 Arabidopsis thaliana protein o... Lus10037863 6.3 0.7950
AT1G73320 S-adenosyl-L-methionine-depend... Lus10031894 8.7 0.7216
AT3G57170 N-acetylglucosaminyl transfera... Lus10003248 12.5 0.7751
AT1G26355 SP1L1 SPIRAL1-like1 (.1) Lus10037069 17.9 0.7062
AT1G66140 C2H2ZnF ZFP4 zinc finger protein 4 (.1) Lus10026597 17.9 0.7552

Lus10025049 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.