Lus10025056 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039942 48 / 7e-08 AT2G34320 45 / 7e-06 Polynucleotidyl transferase, ribonuclease H-like superfamily protein (.1)
Poplar homologues

No hit found

PFAM info
Representative CDS sequence
>Lus10025056 pacid=23167816 polypeptide=Lus10025056 locus=Lus10025056.g ID=Lus10025056.BGIv1.0 annot-version=v1.0
ATGCTCAAAACCCCGACAAAGAAGGGTCTGGAGCCCAGGACGAAGGAGCCCAAGACTAAATTTCAATCCCAAATTCCATTTACAACGGTTGCAACATTGG
AGAAGGTTCGGGTTGGGTGTGGACGCATGGCTCGTGTGCAAGCAGGGTGGAAGGTCGTGAGAGCAAGCGGGGCAGTTGGCACTGATAGGCCTAGTACTAG
GGCAGTCAAGTGCGAGAAGTGGCATTCTCCGCCTCGGGGGAGGACTAACTATTGTAACGTCGATGAGATTTTTCGTCAAGGGGAGCATTGGTGGGGATGT
GGGATGGCCCTACGCAACCATGCACACTAG
AA sequence
>Lus10025056 pacid=23167816 polypeptide=Lus10025056 locus=Lus10025056.g ID=Lus10025056.BGIv1.0 annot-version=v1.0
MLKTPTKKGLEPRTKEPKTKFQSQIPFTTVATLEKVRVGCGRMARVQAGWKVVRASGAVGTDRPSTRAVKCEKWHSPPRGRTNYCNVDEIFRQGEHWWGC
GMALRNHAH

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
Lus10025056 0 1
Lus10002009 2.2 1.0000
Lus10010663 4.2 1.0000
AT3G26140 Cellulase (glycosyl hydrolase ... Lus10032312 4.6 1.0000
AT2G21720 Plant protein of unknown funct... Lus10007431 5.7 1.0000
Lus10014229 6.0 1.0000
Lus10033171 6.3 1.0000
AT2G39518 Uncharacterised protein family... Lus10031304 6.7 1.0000
AT5G64820 unknown protein Lus10025572 6.7 1.0000
AT4G03230 S-locus lectin protein kinase ... Lus10031602 7.3 1.0000
AT2G20825 ULT ULT2 ULTRAPETALA 2, Developmental r... Lus10038586 8.9 1.0000

Lus10025056 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.