Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser]
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G36040 96 / 2e-26 J11 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) AT2G17880 91 / 2e-24 Chaperone DnaJ-domain superfamily protein (.1) AT4G13830 66 / 1e-14 J20 DNAJ-like 20 (.1.2) AT3G13310 64 / 6e-14 Chaperone DnaJ-domain superfamily protein (.1) AT4G39960 65 / 2e-13 Molecular chaperone Hsp40/DnaJ family protein (.1) AT5G03160 61 / 7e-12 ATP58IPK homolog of mamallian P58IPK (.1) AT2G22360 60 / 9e-12 DNAJ heat shock family protein (.1) AT1G80030 59 / 4e-11 Molecular chaperone Hsp40/DnaJ family protein (.1.2.3) AT1G59725 58 / 4e-11 DNAJ heat shock family protein (.1) AT4G37480 57 / 1e-10 Chaperone DnaJ-domain superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10034484 [exp] 199 / 1e-67 AT4G36040 100 / 3e-28 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10028453 [exp] 91 / 2e-24 AT2G17880 146 / 2e-45 Chaperone DnaJ-domain superfamily protein (.1) Lus10041906 [exp] 89 / 2e-23 AT4G36040 144 / 8e-45 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10017263 [exp] 88 / 6e-23 AT4G36040 106 / 2e-29 DnaJ11, Chaperone DnaJ-domain superfamily protein (.1) Lus10003150 [exp] 75 / 1e-17 AT4G13830 151 / 3e-46 DNAJ-like 20 (.1.2) Lus10002355 [exp] 74 / 2e-17 AT4G13830 139 / 2e-41 DNAJ-like 20 (.1.2) Lus10032957 [exp] 72 / 2e-17 AT3G13310 109 / 2e-31 Chaperone DnaJ-domain superfamily protein (.1) Lus10002356 [exp] 71 / 2e-16 AT4G13830 144 / 1e-43 DNAJ-like 20 (.1.2) Lus10003149 [exp] 69 / 3e-15 AT4G13830 141 / 5e-42 DNAJ-like 20 (.1.2)
Poplar homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.004G172300 [exp] 126 / 3e-38 AT2G17880 115 / 2e-33 Chaperone DnaJ-domain superfamily protein (.1) Potri.009G131800 [exp] 114 / 2e-34 AT2G17880 109 / 9e-32 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020700 [exp] 100 / 5e-28 AT2G17880 108 / 3e-30 Chaperone DnaJ-domain superfamily protein (.1) Potri.002G020800 [exp] 94 / 2e-25 AT2G17880 110 / 3e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G240700 [exp] 93 / 4e-25 AT2G17880 105 / 2e-29 Chaperone DnaJ-domain superfamily protein (.1) Potri.005G113100 [exp] 89 / 4e-24 AT2G17880 139 / 6e-43 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G469600 [exp] 76 / 1e-18 AT3G13310 120 / 4e-35 Chaperone DnaJ-domain superfamily protein (.1) Potri.007G107600 [exp] 74 / 8e-18 AT3G13310 109 / 4e-31 Chaperone DnaJ-domain superfamily protein (.1) Potri.001G319100 [exp] 71 / 3e-16 AT4G13830 157 / 8e-49 DNAJ-like 20 (.1.2) Potri.006G001301 [exp] 67 / 3e-15 AT3G13310 102 / 2e-28 Chaperone DnaJ-domain superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0392 [flax] [poplar] Chaperone-J PF00226 [flax] [poplar] DnaJ DnaJ domain
Representative CDS sequence Show only first row Show all	>Lus10025060 pacid=23167821 polypeptide=Lus10025060 locus=Lus10025060.g ID=Lus10025060.BGIv1.0 annot-version=v1.0 ATGGCGTCCTTGTCACTCTACCAAGTCCTGGGAATTCCGACCACAGCCACCGGAGGCGATATAAAGGCGGCGTACCGCCGGCTAGCGAGGACTTGCCACC CGGACGTCGTTTCGGTTGGCGGGAAACAGGAGATGATTTCATCCGGCGAGGACGCGTTCAAGAGGATCAATTCGGCTTACTCCACGCTGTCAGATCCGGA CAAGCGCGCGAATTACGACCGGGATCTGTACCGCCGTCCATTTGGGTCGTCGCTGTCGATGAATTGCAATCCTGGTGCTGGGTCCGGTTCCGGCGGCGGC CGGAGGAACTGGGAGACCGATCAGTGCTGGTAG
AA sequence Show only first row Show all	>Lus10025060 pacid=23167821 polypeptide=Lus10025060 locus=Lus10025060.g ID=Lus10025060.BGIv1.0 annot-version=v1.0 MASLSLYQVLGIPTTATGGDIKAAYRRLARTCHPDVVSVGGKQEMISSGEDAFKRINSAYSTLSDPDKRANYDRDLYRRPFGSSLSMNCNPGAGSGSGGG RRNWETDQCW

---

DESeq2's median of ratios [FLAX]

Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	HYP	R_s2_CTR	R_s2_Fox	R_s4_CTR	R_s4_Fox	R_r1_CTR	R_r1_Fox	R_r3_CTR	R_r3_Fox	R_r1s2_CTR	R_r1s2_Fox	R_r3s2_CTR	R_r3s2_Fox	R_s6_CTR	R_s6_Al4	R_s6_Al12	R_s6_Al24	R_s8_CTR	R_s8_Al4	R_s8_Al12	R_s8_Al24	R_r5_CTR	R_r5_Al4	R_r5_Al12	R_r5_Al24	R_r7_CTR	R_r7_Al4	R_r7_Al12	R_r7_Al24	LEAF_N	LEAF_P	LEAF_NPK	SAM	AR_Bet	AR_rdf	cPAR	TOP_Bet	TOP_rdf	iFIBa	iFIBb	MID_Bet	MID_rdf	tFIBa	tFIB_Gr	tFIB_Li	tFIB_Bi	tFIBb	tFIBb_PUL8	tFIBb_PUL24	tFIBb_PUL96	tFIBb_OPP8	tFIBb_OPP24	tFIBb_OPP96	sXYLa	sXYLb	sXYLb_PUL8	sXYLb_PUL24	sXYLb_PUL96	sXYLb_OPP8	sXYLb_OPP24	sXYLb_OPP96
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10025060 [exp]	0	1
AT5G59550			zinc finger (C3HC4-type RING f...		Lus10010856 [exp]	1.4	0.9123
AT4G28570			Long-chain fatty alcohol dehyd...		Lus10008239 [exp]	2.0	0.8942
AT3G57170			N-acetylglucosaminyl transfera...		Lus10003248 [exp]	4.5	0.8379
AT4G36040		J11	DnaJ11, Chaperone DnaJ-domain ...		Lus10034484 [exp]	7.7	0.8348
AT4G01030			pentatricopeptide (PPR) repeat...		Lus10040917 [exp]	7.9	0.8406
AT1G69160			unknown protein		Lus10026677 [exp]	10.4	0.7743
AT1G27180			disease resistance protein (TI...		Lus10023093 [exp]	12.6	0.7975
AT1G32400		TOM2A	tobamovirus multiplication 2A ...		Lus10040108 [exp]	13.4	0.8073
AT1G30280			Chaperone DnaJ-domain superfam...		Lus10005923 [exp]	14.3	0.8330
AT4G03140			NAD(P)-binding Rossmann-fold s...		Lus10040909 [exp]	15.0	0.8078

Compare expression of checked genes

Lus10025060 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.