Lus10025063 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 144 / 4e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 144 / 5e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 142 / 2e-42 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 135 / 1e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 135 / 3e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 134 / 6e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 134 / 6e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 133 / 1e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT3G13662 128 / 8e-37 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034482 403 / 7e-144 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 234 / 1e-77 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025064 231 / 2e-77 AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 232 / 1e-76 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034479 226 / 5e-75 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 219 / 1e-71 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 213 / 5e-69 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 207 / 1e-67 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 202 / 2e-65 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 194 / 1e-62 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 168 / 4e-52 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 166 / 3e-51 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 163 / 2e-50 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060900 161 / 2e-49 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 158 / 1e-48 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 155 / 3e-47 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 155 / 5e-47 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.003G216400 153 / 3e-46 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G009100 150 / 4e-45 AT1G58170 238 / 1e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10025063 pacid=23167847 polypeptide=Lus10025063 locus=Lus10025063.g ID=Lus10025063.BGIv1.0 annot-version=v1.0
ATGACGACAAAACCCTCCTTAATCGTCGTCGTCGCCATCACAATCGCCCTCTCATCATCGATCCCCTCATTCCTCGCTCAACAGCCCCCGACTCCCTCTC
CGGCCGCCGTCAGCTGGGCGACCCGCCTCCCCTCCTCCTCCGGCGGCGACGCCGTCACCAATCTCCAGTTCTACTTCCACGACATCCTCAGCGGGAACAA
CCCGACAGCCGTCCAGGTCGCCTCCCCAGCGGCCGGATCCGGGTTCGGATCCATCACGATGGCTGATGACCCGCTCACCGAGACATCCGACCCGAACTCC
AAGCTAGTCGGGCGGGCTCAGGGGATCTACGCCTCCGCCTCGCAGTCCACGCTGGCGCTGCTGATGTCGATGAGCTACAGCTTCGTCGATGGGCCATACA
GCGGGAGCTCGCTGAGCATATTGGGCCGGAACGAGGTTATGACCCAGGGTCGGGAACTGCCTGTTTTGGGTGGCACGGGGCTGTTCAGGATGGCGCGTGG
ATACGCCGTGCTCCAAACGACGTCGGCTAATTCGGCCGGGGACGCCGTCGTGTTTTATAATGTGACGGTCTTTGCCCCTTCGTCTAATGCCCAGAATGAG
GCGCTTCCGTTCACTCCCGTTGATGGTGGGAGGAGGAGTGGAGGAGGCGGCGGTGGGAATGCAGGGGATTCTTCGCCGGCGGGTAGAGTGCCGGCGAATG
GGTGGGTTGCTGCGGCGGTGGTGGCTGCTGTGGCGTGTGTTTTGTCGATGTGA
AA sequence
>Lus10025063 pacid=23167847 polypeptide=Lus10025063 locus=Lus10025063.g ID=Lus10025063.BGIv1.0 annot-version=v1.0
MTTKPSLIVVVAITIALSSSIPSFLAQQPPTPSPAAVSWATRLPSSSGGDAVTNLQFYFHDILSGNNPTAVQVASPAAGSGFGSITMADDPLTETSDPNS
KLVGRAQGIYASASQSTLALLMSMSYSFVDGPYSGSSLSILGRNEVMTQGRELPVLGGTGLFRMARGYAVLQTTSANSAGDAVVFYNVTVFAPSSNAQNE
ALPFTPVDGGRRSGGGGGGNAGDSSPAGRVPANGWVAAAVVAAVACVLSM

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10025063 0 1
AT5G54800 ATGPT1, GPT1 ARABIDOPSIS GLUCOSE 6-PHOSPHAT... Lus10011155 4.4 0.9396
AT3G17390 MAT4, SAMS3, MT... S-ADENOSYLMETHIONINE SYNTHETAS... Lus10038044 7.3 0.9269
AT1G68620 alpha/beta-Hydrolases superfam... Lus10041473 9.5 0.8987
AT4G39980 DHS1 3-deoxy-D-arabino-heptulosonat... Lus10025739 10.1 0.9282
AT4G39230 NmrA-like negative transcripti... Lus10026348 12.8 0.9214
AT2G27080 Late embryogenesis abundant (L... Lus10026762 13.4 0.8751
AT5G56980 unknown protein Lus10014282 14.5 0.8535
AT2G05940 RIPK RPM1-induced protein kinase, P... Lus10013148 15.0 0.8691
AT2G43630 unknown protein Lus10013892 15.2 0.8797
AT1G22410 Class-II DAHP synthetase famil... Lus10035923 16.0 0.9182

Lus10025063 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.