Lus10025064 [FLAX]


External link
JGI Phytozome v13
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G21100 197 / 9e-65 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42510 165 / 2e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G42500 153 / 1e-47 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G22900 142 / 4e-43 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G65870 136 / 5e-41 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G58170 133 / 9e-40 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT3G13650 132 / 2e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT5G49040 131 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1)
AT1G55210 131 / 5e-39 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
AT3G13662 129 / 3e-38 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10034479 332 / 2e-118 AT2G21100 189 / 9e-62 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025065 260 / 5e-89 AT2G21100 199 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034478 258 / 4e-88 AT2G21100 191 / 1e-61 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034476 233 / 9e-79 AT2G21100 220 / 1e-73 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10027834 233 / 2e-78 AT2G21100 182 / 5e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10034482 232 / 1e-77 AT2G21100 182 / 8e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025063 232 / 1e-77 AT2G21100 183 / 4e-58 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10005062 228 / 3e-76 AT2G21100 184 / 7e-59 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Lus10025067 217 / 2e-72 AT2G21100 214 / 3e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Poplar homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.009G131000 201 / 1e-66 AT2G21100 236 / 4e-80 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023800 162 / 5e-51 AT3G13650 171 / 2e-54 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G061000 161 / 1e-50 AT1G58170 214 / 2e-71 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G214600 159 / 3e-50 AT2G21100 164 / 6e-52 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.006G195300 157 / 3e-49 AT5G49040 202 / 2e-66 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216300 154 / 5e-48 AT1G55210 221 / 5e-74 Disease resistance-responsive (dirigent-like protein) family protein (.1), Disease resistance-responsive (dirigent-like protein) family protein (.2)
Potri.016G060900 154 / 8e-48 AT1G58170 197 / 1e-64 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.003G216400 154 / 1e-47 AT1G58170 225 / 1e-75 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.016G060700 152 / 4e-47 AT1G65870 186 / 2e-60 Disease resistance-responsive (dirigent-like protein) family protein (.1)
Potri.001G023600 148 / 1e-45 AT5G49040 146 / 1e-44 Disease resistance-responsive (dirigent-like protein) family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0650 AOC_barrel PF03018 Dirigent Dirigent-like protein
Representative CDS sequence
>Lus10025064 pacid=23167749 polypeptide=Lus10025064 locus=Lus10025064.g ID=Lus10025064.BGIv1.0 annot-version=v1.0
ATGTCTGCACTTCAGGCCCAAACACCACCACCACTCAAATGGGCACAAAGACTGGACTCTGGAACGGGCCCGGAGTCCGTAACCAACCTCCAGTTCTACT
TCCACGACATCCTGAGCGGATCCAACCCCACCGCGAAGCGCGTCGTCCAACCCATTGTGGGGACCACCATCACGACCCTCTTTGGAGCGATCGTGATGGC
AGACGACCCGCTGACAGAGACATCTGACCCAGGGTCCAAGCTCGTTGGAAGGGCTCAAGGAATGTACAGCTCATCTAGCCAGGAAGATATCGCTCTGTTG
ATGGTCATGAGTTACGGGTTCACGGACGGACCCTACAACGGGAGCTCGATCAGCATCATGGGTAAGAACCCGGCCATGAACCCGACGAGGGAGCTCCCAG
TTTTGGGCGGCACGGGCGTTTTTAGGATGGCACGTGGGTACGCGGCAATGAAAACGGTGTCGGTTAATGCTGGCGGGGATGCCGTTGTGTTTTATAACGT
CACGGTGTACACTCCGGCTTCTAATTAA
AA sequence
>Lus10025064 pacid=23167749 polypeptide=Lus10025064 locus=Lus10025064.g ID=Lus10025064.BGIv1.0 annot-version=v1.0
MSALQAQTPPPLKWAQRLDSGTGPESVTNLQFYFHDILSGSNPTAKRVVQPIVGTTITTLFGAIVMADDPLTETSDPGSKLVGRAQGMYSSSSQEDIALL
MVMSYGFTDGPYNGSSISIMGKNPAMNPTRELPVLGGTGVFRMARGYAAMKTVSVNAGGDAVVFYNVTVYTPASN

DESeq2's median of ratios [FLAX]

Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol HYPR_s2_CTRR_s2_FoxR_s4_CTRR_s4_FoxR_r1_CTRR_r1_FoxR_r3_CTRR_r3_FoxR_r1s2_CTRR_r1s2_FoxR_r3s2_CTRR_r3s2_FoxR_s6_CTRR_s6_Al4R_s6_Al12R_s6_Al24R_s8_CTRR_s8_Al4R_s8_Al12R_s8_Al24R_r5_CTRR_r5_Al4R_r5_Al12R_r5_Al24R_r7_CTRR_r7_Al4R_r7_Al12R_r7_Al24LEAF_NLEAF_PLEAF_NPKSAMAR_BetAR_rdfcPARTOP_BetTOP_rdfiFIBaiFIBbMID_BetMID_rdftFIBatFIB_GrtFIB_LitFIB_BitFIBbtFIBb_PUL8tFIBb_PUL24tFIBb_PUL96tFIBb_OPP8tFIBb_OPP24tFIBb_OPP96sXYLasXYLbsXYLb_PUL8sXYLb_PUL24sXYLb_PUL96sXYLb_OPP8sXYLb_OPP24sXYLb_OPP96
AT2G21100 Disease resistance-responsive ... Lus10025064 0 1
AT3G11550 CASP2 Casparian strip membrane domai... Lus10029409 2.2 0.9547
AT1G71740 unknown protein Lus10042773 2.4 0.9491
Lus10025501 3.5 0.9419
AT3G24020 Disease resistance-responsive ... Lus10023689 5.2 0.9439
AT3G24020 Disease resistance-responsive ... Lus10011767 7.1 0.9378
AT2G21100 Disease resistance-responsive ... Lus10034479 7.5 0.9346
AT3G08680 Leucine-rich repeat protein ki... Lus10021383 8.8 0.9215
AT3G08680 Leucine-rich repeat protein ki... Lus10025210 8.8 0.9368
AT2G30210 LAC3 laccase 3 (.1) Lus10042249 9.5 0.9292
AT1G28340 AtRLP4 receptor like protein 4 (.1) Lus10013994 9.9 0.9225

Lus10025064 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.